BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00850 (774 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 4.5 AY146731-1|AAO12091.1| 150|Anopheles gambiae odorant-binding pr... 23 7.9 AF437887-1|AAL84182.1| 150|Anopheles gambiae odorant binding pr... 23 7.9 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.2 bits (50), Expect = 4.5 Identities = 20/82 (24%), Positives = 35/82 (42%) Frame = +2 Query: 131 IVKMAVNVYSTNVTSENLSRHDMLAWVNDCLQSNFAKIEELLQVPPIASSWTCCSLAVYQ 310 I+ +A ++ T E L L ++ CL++ ++ V ++ T L Sbjct: 187 ILGLAGPLHGAGCTPERLCWE--LHYLERCLRARIETASDITSVLRFSTKPTELILECIP 244 Query: 311 *KESNLRQIWNMNIYRTLKYYK 376 K SNL Q+ M I R + + K Sbjct: 245 PKPSNLTQLLRMLIQRQIAFLK 266 >AY146731-1|AAO12091.1| 150|Anopheles gambiae odorant-binding protein AgamOBP4 protein. Length = 150 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -2 Query: 485 SKNFLNHCKNSKLSWKRP 432 +K L HCK+++ S+K P Sbjct: 111 AKEALTHCKDTQTSYKDP 128 >AF437887-1|AAL84182.1| 150|Anopheles gambiae odorant binding protein protein. Length = 150 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -2 Query: 485 SKNFLNHCKNSKLSWKRP 432 +K L HCK+++ S+K P Sbjct: 111 AKEALTHCKDTQTSYKDP 128 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 827,906 Number of Sequences: 2352 Number of extensions: 17491 Number of successful extensions: 31 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -