BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00848 (708 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U56965-10|AAB52670.1| 1041|Caenorhabditis elegans Nicotinamide n... 89 4e-18 >U56965-10|AAB52670.1| 1041|Caenorhabditis elegans Nicotinamide nucleotide transhydrogenaseprotein 1 protein. Length = 1041 Score = 88.6 bits (210), Expect = 4e-18 Identities = 39/65 (60%), Positives = 51/65 (78%) Frame = +3 Query: 513 DNEIQNVRNEGTLISFLYPAQNQDLIKKLSERKMNAFAMDCIPRISRAQAFDALSSMANV 692 +NE+ +++ TLISF++P QNQ L+ L++ FAMDC+PRISRAQ FDALSSMAN+ Sbjct: 105 ENEVSKLKSGCTLISFIHPGQNQALLDSLTKTDKTVFAMDCVPRISRAQVFDALSSMANI 164 Query: 693 AGYRA 707 AGYRA Sbjct: 165 AGYRA 169 Score = 62.9 bits (146), Expect = 2e-10 Identities = 29/80 (36%), Positives = 44/80 (55%) Frame = +1 Query: 271 VSYTKLSIGVPKEIWQDERRXXXXXXXXXXXXXXGFHVNVEEDAGAVANFPNKTFEEAGA 450 + Y+KL + VPKEI+ E+R G V +EE+AG +A + N+ + +GA Sbjct: 24 IEYSKLKVAVPKEIFPGEKRVSLSPNGVALLKKNGISVLIEENAGVLAGYSNEEYVRSGA 83 Query: 451 KITNLKTTFQSDIVLKVRPP 510 + F +DI+LKVRPP Sbjct: 84 DVGKHNEVFNTDIMLKVRPP 103 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,610,549 Number of Sequences: 27780 Number of extensions: 298548 Number of successful extensions: 728 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 728 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1645110168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -