BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00846 (761 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 27 0.22 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 27 0.22 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 27 0.22 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 27 0.22 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 24 1.2 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 2.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.7 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.7 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 23 3.5 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 8.1 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 26.6 bits (56), Expect = 0.22 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 62 QPDSMATITMKPEYPPSEVYS-TSEPPP 142 QP ++ + + P++PPSE Y+ S PP Sbjct: 18 QPQHISGVVVDPKFPPSEEYNQNSYIPP 45 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 26.6 bits (56), Expect = 0.22 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 62 QPDSMATITMKPEYPPSEVYS-TSEPPP 142 QP ++ + + P++PPSE Y+ S PP Sbjct: 18 QPQHISGVVVDPKFPPSEEYNQNSYIPP 45 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 26.6 bits (56), Expect = 0.22 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 62 QPDSMATITMKPEYPPSEVYS-TSEPPP 142 QP ++ + + P++PPSE Y+ S PP Sbjct: 18 QPQHISGVVVDPKFPPSEEYNQNSYIPP 45 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 26.6 bits (56), Expect = 0.22 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 62 QPDSMATITMKPEYPPSEVYS-TSEPPP 142 QP ++ + + P++PPSE Y+ S PP Sbjct: 18 QPQHISGVVVDPKFPPSEEYNQNSYIPP 45 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -3 Query: 141 GGGSDVLYTSEGGYSGFIVIVAI--ESGW 61 G G+ YT E G G+ IV + E GW Sbjct: 283 GAGNSGKYTGEAGMLGYNEIVELQKEGGW 311 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 171 TEVDTLCR*AGGGSDVLYTSEGGYSGFIVI 82 T+ D +GGG+ YT+E G+ F I Sbjct: 773 TQFDIGAPASGGGTPGKYTAEAGFMSFYEI 802 Score = 21.8 bits (44), Expect = 6.1 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 144 AGGGSDVLYTSEGGYSGF 91 +GGG + YT E G+ + Sbjct: 353 SGGGKEGTYTKESGFLAY 370 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 2.7 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 Query: 56 EHQPDSMATITMKPEYPPSEVYSTSEPPPAY 148 E P A + E PPS ST PPP + Sbjct: 1780 EEPPSVEAVEEEREEAPPSVHSSTVVPPPQH 1810 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +1 Query: 199 SGRFLLHLGNLYIGFELGRARSSCHQLEQLDA 294 +GRF H NLY F + + L+ +D+ Sbjct: 169 TGRFTFHKKNLYYSFYISDKAARPRSLQFVDS 200 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/40 (30%), Positives = 15/40 (37%) Frame = +2 Query: 74 MATITMKPEYPPSEVYSTSEPPPAYRHRVSTSVQIAKIAA 193 + T+ E PP Y EPP Y R K+ A Sbjct: 11 LPTVLPHQEVPPPFGYYHEEPPLFYEERPDFVAPYIKVEA 50 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.4 bits (43), Expect = 8.1 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 Query: 135 GSDVLYTSEGGYSGF 91 G VLYT GY GF Sbjct: 481 GDAVLYTIHMGYHGF 495 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,288 Number of Sequences: 336 Number of extensions: 3547 Number of successful extensions: 17 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -