BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00846 (761 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 7.8 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 23 7.8 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 7.8 Identities = 16/66 (24%), Positives = 23/66 (34%) Frame = +1 Query: 334 GNDALVADEPLPLANAHALHGVPPMLSSVLPETSQPSSSRPSLFKDDALNHAESKINEAN 513 G A A P P H L PP + + P QP P+ + E +N N Sbjct: 909 GPGAAAATGPPP--PTHRLEQ-PPQVVAAAPTQQQPLPPAPAAASSAGVQPTEHSVNSTN 965 Query: 514 CRKLTT 531 + + Sbjct: 966 VTSINS 971 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 23.4 bits (48), Expect = 7.8 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 110 SEVYSTSEPPPAYRHRVS 163 +++YST EP A+ R+S Sbjct: 427 TDIYSTREPQLAFHQRIS 444 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 756,754 Number of Sequences: 2352 Number of extensions: 15349 Number of successful extensions: 35 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -