BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00842 (785 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 101 3e-23 AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase p... 25 2.7 AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. 25 2.7 DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosylt... 24 6.1 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 101 bits (241), Expect = 3e-23 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = +2 Query: 344 NAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVL 511 +AVITVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVL Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVL 56 Score = 41.1 bits (92), Expect = 4e-05 Identities = 17/20 (85%), Positives = 20/20 (100%) Frame = +1 Query: 508 IIFDLGGGTFDVSILTIEDG 567 +IFDLGGGTFDVSILTI++G Sbjct: 56 LIFDLGGGTFDVSILTIDEG 75 >AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase protein. Length = 557 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -3 Query: 612 TSQVGVAGGGFHLEDTILDGKDGHVEGTAAEVKDNTFRSPVP 487 T ++G G + D I D H A + FRSP+P Sbjct: 364 TCRLGECSLGCLVADAIADYYTNHTFHPVAIINAGNFRSPIP 405 >AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. Length = 557 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -3 Query: 612 TSQVGVAGGGFHLEDTILDGKDGHVEGTAAEVKDNTFRSPVP 487 T ++G G + D I D H A + FRSP+P Sbjct: 364 TCRLGECSLGCLVADAIADYYTNHTFHPVAIINAGNFRSPIP 405 >DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosyltransferase 1 protein. Length = 399 Score = 23.8 bits (49), Expect = 6.1 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 277 FLGEKGFVSPLYATLILGLPPSLTTSKGQ 191 FLG GF L TL+ LPP + KG+ Sbjct: 42 FLGSFGFAKALNRTLV--LPPWVEYRKGE 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 875,751 Number of Sequences: 2352 Number of extensions: 19635 Number of successful extensions: 56 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -