BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00840 (768 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0671 + 10315260-10315370,10315984-10316027,10316141-103162... 29 5.4 >03_02_0671 + 10315260-10315370,10315984-10316027,10316141-10316204, 10316278-10316392,10316504-10316571,10316917-10317014, 10317543-10317657,10318425-10318641,10319541-10319667, 10319803-10319857,10319997-10320093,10320748-10320876, 10320964-10321097,10321660-10321746,10321998-10322069, 10322320-10322359,10322535-10322779,10323587-10323764, 10323931-10324136,10324681-10324977 Length = 832 Score = 28.7 bits (61), Expect = 5.4 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = -2 Query: 224 GFRFVFVKLDELVCFVASALFSL--KITVSDLNDE 126 GF+ + K+D+L +AS L SL K +SDL+D+ Sbjct: 642 GFKLMKTKMDQLYATLASTLKSLQGKSDISDLSDD 676 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,977,356 Number of Sequences: 37544 Number of extensions: 377924 Number of successful extensions: 780 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 780 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -