BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00839 (736 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY500354-1|AAS55104.1| 445|Homo sapiens zinc finger protein 11 ... 30 7.5 AB209500-1|BAD92737.1| 246|Homo sapiens PREDICTED: similar to Z... 30 9.9 >AY500354-1|AAS55104.1| 445|Homo sapiens zinc finger protein 11 protein. Length = 445 Score = 30.3 bits (65), Expect = 7.5 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -2 Query: 735 RKTQHLKHYKQFHTNSNMYHLSKTGKLYLR 646 R++QHL +++ HT +Y S+ GK + R Sbjct: 343 RRSQHLMTHQKIHTGVKLYKCSECGKCFCR 372 >AB209500-1|BAD92737.1| 246|Homo sapiens PREDICTED: similar to Zinc finger protein 93 (Zinc finger protein HTF34) varian protein. Length = 246 Score = 29.9 bits (64), Expect = 9.9 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -2 Query: 735 RKTQHLKHYKQFHTNSNMYHLSKTGKLYLRACS 637 +++ HL +K+ HT Y + GK Y ++C+ Sbjct: 145 KQSSHLTTHKKIHTGEKPYKCEECGKAYKQSCN 177 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,299,461 Number of Sequences: 237096 Number of extensions: 1594365 Number of successful extensions: 4681 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4680 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8735159784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -