BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00839 (736 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein pro... 24 1.3 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 22 6.9 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 21 9.1 >L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein protein. Length = 74 Score = 24.2 bits (50), Expect = 1.3 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = -2 Query: 732 KTQHLKHYKQFHTNSNMYHLSKTGKLYLRACS 637 + HLK + + HT YH S + +++ + Sbjct: 21 RDHHLKTHMRLHTGEKPYHCSHCDRQFVQVAN 52 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 21.8 bits (44), Expect = 6.9 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -1 Query: 541 LYLYYSCTNGNKFDEQY*KKKENTFYFDNDKV 446 +Y+Y NG K E + EN Y K+ Sbjct: 39 MYVYEEIINGKKLTEIINETHENVKYLPGHKL 70 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 321 RAMDRGTIRNSLIFLKRKVKKKQTKIYYS 235 R D GT+ +L+F++ K K ++ S Sbjct: 444 RENDSGTLGGTLVFVEMKKKADFIAVFLS 472 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,809 Number of Sequences: 438 Number of extensions: 3877 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -