BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00837 (713 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0991 - 10057736-10058249,10058412-10059241,10059266-100606... 28 8.5 09_02_0159 + 5105272-5106360,5107605-5107769 28 8.5 >12_01_0991 - 10057736-10058249,10058412-10059241,10059266-10060633, 10061785-10062327,10066274-10066498,10066590-10066640 Length = 1176 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/64 (18%), Positives = 35/64 (54%) Frame = -1 Query: 332 ISLYRVNYIIIISTFYLIM*WIILCLYIFFIMTYSYRYFIRNNEEKKKTFFVVYVMLILP 153 + L ++ + ++ +++ W++LCL + F ++ YF+ + ++KK + V + + Sbjct: 1109 VDLEHISLYLGMAIGFVLSLWVVLCL-LLFKTSWRKSYFMFVDRQQKKIYVSVKIRSAVL 1167 Query: 152 KKNI 141 K+ + Sbjct: 1168 KRKL 1171 >09_02_0159 + 5105272-5106360,5107605-5107769 Length = 417 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 311 NLHDKVIFFKIVLNIKVVFSYYGLILMINIAFYLL 415 NL D+V FFK L +K F+Y ++ + + Y L Sbjct: 126 NLLDQVRFFKAELWVKFYFNYVPVVYLSEASIYAL 160 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,524,128 Number of Sequences: 37544 Number of extensions: 245970 Number of successful extensions: 366 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 366 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -