BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00837 (713 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 24 5.4 U50475-1|AAA93477.1| 207|Anopheles gambiae protein ( Anopheles ... 24 5.4 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 24 5.4 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 24 5.4 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 24 5.4 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 24 5.4 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 23 7.2 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 7.2 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 406 LSFNPFVISEVTLVSFSWYLEYF 474 L+FN VI +VT Y +YF Sbjct: 445 LNFNGVVIKDVTFDKLMTYFDYF 467 >U50475-1|AAA93477.1| 207|Anopheles gambiae protein ( Anopheles gambiae putativearylphorin precursor, mRNA, partial cds. ). Length = 207 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 406 LSFNPFVISEVTLVSFSWYLEYF 474 L+FN VI +VT Y +YF Sbjct: 113 LNFNGVVIKDVTFDKLMTYFDYF 135 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 23.8 bits (49), Expect = 5.4 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = -1 Query: 263 LCLYIFFIMTYS 228 +CLY+FFI+T S Sbjct: 235 ICLYLFFIITLS 246 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 406 LSFNPFVISEVTLVSFSWYLEYF 474 L+FN VI +VT Y +YF Sbjct: 445 LNFNGVVIKDVTFDKLMTYFDYF 467 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 406 LSFNPFVISEVTLVSFSWYLEYF 474 L+FN VI +VT Y +YF Sbjct: 445 LNFNGVVIKDVTFDKLMTYFDYF 467 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 406 LSFNPFVISEVTLVSFSWYLEYF 474 L+FN VI +VT Y +YF Sbjct: 445 LNFNGVVIKDVTFDKLMTYFDYF 467 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 23.4 bits (48), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 343 CTKYKSCIFLLRSDFNDKHCVL 408 CT+ +SC R DFN + +L Sbjct: 73 CTRLRSCCTRQRKDFNPRKHLL 94 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.4 bits (48), Expect = 7.2 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -1 Query: 545 LFTHLKFTS*FDTRQTSRDSVRRVK-YSKYHEKETKVTSEITN 420 +F H F + +Q D R+V Y K+H+++TK ITN Sbjct: 3036 IFEHF-FNTANQGKQDQED--RKVNPYLKHHKRQTKTPFHITN 3075 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 646,933 Number of Sequences: 2352 Number of extensions: 11451 Number of successful extensions: 19 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -