BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00836 (724 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 30 0.019 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 28 0.10 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 30.3 bits (65), Expect = 0.019 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 135 EGRDTCQGDGGAPLACP-IGDSRYKLAGLVAWGIGCGQ 245 +G+D CQ D G P+ R G+++WG CG+ Sbjct: 340 KGKDACQMDSGGPVLWQNPRTKRLVNIGIISWGAECGK 377 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 27.9 bits (59), Expect = 0.10 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = -1 Query: 235 PMPQATSPASL*RLSPMGQARGAPPSPWQVSLPSCPP 125 P A P SP RG+PP+P Q P PP Sbjct: 16 PSSGAPGPQPSPHQSPQAPQRGSPPNPSQGPPPGGPP 52 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,166 Number of Sequences: 438 Number of extensions: 4913 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -