BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00833 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 26 1.5 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 24 4.4 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 24 4.4 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 24 4.4 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 24 4.4 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 4.4 AF457560-1|AAL68790.1| 56|Anopheles gambiae hypothetical prote... 24 5.9 Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL... 23 7.7 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 23 7.7 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 514 SFKLFELSNSVDIQE 558 SF LFEL+N+ DIQE Sbjct: 320 SFALFELANNPDIQE 334 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 26 FIFCSIFTFSFYTPALDYYL 45 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 26 FIFCSIFTFSFYTPALDYYL 45 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 270 FLCCSIFVFIFYL-AYGYFL 326 F+ CSIF F FY A Y+L Sbjct: 37 FIFCSIFTFSFYTPALDYYL 56 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.2 bits (50), Expect = 4.4 Identities = 15/68 (22%), Positives = 30/68 (44%) Frame = +2 Query: 461 NVCSFSCIDIRNNVIFNLALSYLNYPTQLIFKSCKLIPVMIGSIIIMRKRYSFLDYVAAI 640 N+ + + + + F+ L YLN IF S L+ + + ++ D+V I Sbjct: 1636 NMLTMTLDHYKQSETFSAVLDYLNMIFICIFSSECLMKIFALRYHYFIEPWNLFDFVVVI 1695 Query: 641 VMCVGLTM 664 + +GL + Sbjct: 1696 LSILGLVL 1703 >AF457560-1|AAL68790.1| 56|Anopheles gambiae hypothetical protein 13 protein. Length = 56 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 351 VKPVSLYITLVQFMITMLLSYGESWIRNPIKRKVPLK 461 +K V + LV + ++ G I+N +KR +PL+ Sbjct: 1 MKNVFFALLLVVLVCCLVSVQGNEIIQNVVKRSIPLR 37 >Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL10 protein. Length = 204 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 54 N*AIRQHEYLNHICLEIHKQKQI 122 N AIR+ +N IC +HK +++ Sbjct: 139 NNAIRRDPNVNWICNAVHKHREL 161 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 1 VNYNLRKNVEFNLFTNLKIK 60 +NY ++ NV+ N F +L IK Sbjct: 256 INYRVKNNVQRNDFVDLLIK 275 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 706,400 Number of Sequences: 2352 Number of extensions: 14002 Number of successful extensions: 63 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -