BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00831 (762 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25B8.05 |||pseudouridylate synthase |Schizosaccharomyces pom... 27 2.2 SPAC6B12.04c |||aminotransferase class I and II|Schizosaccharomy... 25 8.9 SPAC30.04c |abc4||glutathione S-conjugate-exporting ATPase Abc4|... 25 8.9 >SPAC25B8.05 |||pseudouridylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 27.5 bits (58), Expect = 2.2 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 60 SFLLESLL*NIKRCKKMRNRNPGAKVGASPARPVRRAVPIVSRQ 191 SF+L+ N+KR K + VG + ++ +PI+SRQ Sbjct: 378 SFMLDIADHNVKRYGKSEESSSTMNVGEGLLKRTKKYIPILSRQ 421 >SPAC6B12.04c |||aminotransferase class I and II|Schizosaccharomyces pombe|chr 1|||Manual Length = 421 Score = 25.4 bits (53), Expect = 8.9 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 544 GCVEWRVGWVL 576 GC WRVGW++ Sbjct: 252 GCTGWRVGWLI 262 >SPAC30.04c |abc4||glutathione S-conjugate-exporting ATPase Abc4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1469 Score = 25.4 bits (53), Expect = 8.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 Query: 617 RARCSLYF*LYDYSLK*YYTIRTHYDYYNIN 709 R SLY+ L D+SL THYD +N Sbjct: 17 RVPTSLYYSLSDFSLSAISIFPTHYDQPYLN 47 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,288,292 Number of Sequences: 5004 Number of extensions: 36381 Number of successful extensions: 81 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 365309308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -