BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00831 (762 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1304 + 35581172-35581345,35582504-35582748,35583148-355838... 28 7.1 >02_05_1304 + 35581172-35581345,35582504-35582748,35583148-35583829, 35583908-35584262,35584558-35584649,35584889-35585083, 35585167-35585840,35586134-35586224 Length = 835 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 119 KSWCQSRRLAGTARPPRRTYR-KSAELFTIYFLIMNVFY 232 +SWC++ RLA TA ++ + K +E F Y +N Y Sbjct: 173 ESWCKALRLAATADKEKKNWHAKLSEEFNNYISSLNSEY 211 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,345,817 Number of Sequences: 37544 Number of extensions: 228553 Number of successful extensions: 509 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 509 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2039640244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -