BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00830 (751 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53148| Best HMM Match : rve (HMM E-Value=4.8e-21) 31 1.3 SB_10014| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 >SB_53148| Best HMM Match : rve (HMM E-Value=4.8e-21) Length = 1329 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/65 (24%), Positives = 23/65 (35%) Frame = +2 Query: 329 LSQLHRHCRRLTRKARAHVRSTLATQSRQPYTLHRCPQLRRTKSPNKKCFLPLACNVLPS 508 L H +CR + T S+QP ++H R +P + P C L Sbjct: 161 LQSAHDYCRTYEAAELQKFKFASPTGSQQPLSVHPVQGKERAPNPTSRFTKPSICPALRK 220 Query: 509 LCNLC 523 C C Sbjct: 221 KCRNC 225 >SB_10014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +3 Query: 126 AARSKDLLSRTSPLMNCFRQLRHHFPALESTRRLPKNRAPLRAELAASIRPVLCKDG 296 +A+S+D + T+ L + R + + E+ RRLP LR A V+ +DG Sbjct: 11 SAKSRDHTAETTCLSHAIRSYIYRYLEKETGRRLPTMDDDLRQRFAVHSGNVIVRDG 67 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,677,738 Number of Sequences: 59808 Number of extensions: 412736 Number of successful extensions: 1171 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1164 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -