BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00827 (730 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 23 3.3 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 22 5.8 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 21 7.7 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 7.7 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 279 IVTCITFKNIVTLFKMLLTTIRSKQIIWSKTV 374 + TC+ F + +LTT+R KQ W++ + Sbjct: 66 VQTCLDFLLLALNISTILTTVR-KQQQWAQLI 96 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 21.8 bits (44), Expect = 5.8 Identities = 6/22 (27%), Positives = 14/22 (63%) Frame = +2 Query: 608 LITKQIFYFVIFSFQKLRCEIR 673 +IT F++++ + L CE++ Sbjct: 169 VITSDEFFYLVSKIESLACELK 190 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.4 bits (43), Expect = 7.7 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 354 IIWSKTVNAY*KVAIQICGCILLYSSFMLNF 446 +IW + ++ ILL+ SF LNF Sbjct: 122 LIWKSYKRTQIFITCELFFVILLWISFFLNF 152 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.4 bits (43), Expect = 7.7 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +2 Query: 377 CLLESCNSNLWLHIVILIF 433 C+L +WLH+V + F Sbjct: 263 CVLVQSEKIVWLHLVYISF 281 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,302 Number of Sequences: 336 Number of extensions: 3333 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -