BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00827 (730 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59900.1 68418.m07512 pentatricopeptide (PPR) repeat-containi... 27 9.6 >At5g59900.1 68418.m07512 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 907 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +3 Query: 84 ESLCKKQQHVYS*QITKQLGKKNIMKPFFIYCMIAYD*C 200 + LCKKQ+ + I K L K++ YC + Y C Sbjct: 270 DGLCKKQKVWEAVGIKKDLAGKDLKPDVVTYCTLVYGLC 308 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,167,586 Number of Sequences: 28952 Number of extensions: 238310 Number of successful extensions: 393 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -