BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00820 (690 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19970.1 68416.m02527 expressed protein 28 6.7 At1g69850.1 68414.m08039 nitrate transporter (NTL1) identical to... 27 8.9 At1g27040.2 68414.m03296 nitrate transporter, putative contains ... 27 8.9 At1g27040.1 68414.m03297 nitrate transporter, putative contains ... 27 8.9 >At3g19970.1 68416.m02527 expressed protein Length = 434 Score = 27.9 bits (59), Expect = 6.7 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 284 VSAVLFELFAGLNFIS-VVLKVEEVTKLYSSPSLRSSTVGVTALAALRVI 138 VS V A L+F+S + + V V L S+PS +T VT+L+ALR + Sbjct: 62 VSQVSASKLADLSFVSRICVPVPNVDLLASNPSCSLAT-SVTSLSALRSV 110 >At1g69850.1 68414.m08039 nitrate transporter (NTL1) identical to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 585 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 82 KMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDG 195 K T +E ++ IGVGL+ A AV VE+++ G Sbjct: 414 KATKTETGVTHLQRIGVGLVLSILAMAVAALVEIKRKG 451 >At1g27040.2 68414.m03296 nitrate transporter, putative contains Pfam profile: PF00854 POT family; similar to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 563 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 82 KMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRK 189 K+T SE ++ IGVGL+ A AV VEL++ Sbjct: 393 KVTKSEIGITHLQRIGVGLVLSIVAMAVAALVELKR 428 >At1g27040.1 68414.m03297 nitrate transporter, putative contains Pfam profile: PF00854 POT family; similar to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 567 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 82 KMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRK 189 K+T SE ++ IGVGL+ A AV VEL++ Sbjct: 397 KVTKSEIGITHLQRIGVGLVLSIVAMAVAALVELKR 432 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,189,969 Number of Sequences: 28952 Number of extensions: 285177 Number of successful extensions: 742 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 741 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -