BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00819 (708 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|c... 29 0.49 SPAC3C7.06c |pit1||serine/threonine protein kinase Pit1|Schizosa... 29 0.86 SPBC4B4.01c |||fumble family pantothenate kinase |Schizosaccharo... 26 6.1 SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual 26 6.1 SPBC530.15c ||SPBC661.01|spermidine family transporter |Schizosa... 25 8.0 >SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 288 Score = 29.5 bits (63), Expect = 0.49 Identities = 17/60 (28%), Positives = 35/60 (58%), Gaps = 9/60 (15%) Frame = +3 Query: 276 YFVGFQN-SEVMINRDNWGHSYCDVRGEILG------SSQD--EHQRKHLPKVFSSIKNE 428 Y VG+ N + ++++ WGHS+ +V E+L +QD E ++K+L ++ +S + + Sbjct: 142 YIVGYPNEARLLMDNFKWGHSFFEVNEELLDIYAQCHDAQDIQEKEKKYLEEMEASYQEQ 201 >SPAC3C7.06c |pit1||serine/threonine protein kinase Pit1|Schizosaccharomyces pombe|chr 1|||Manual Length = 650 Score = 28.7 bits (61), Expect = 0.86 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = -1 Query: 651 FPVLSQIKPQAPLLVVPFRQFL*VSALQPYSPRSPKSLVSRKLPAEPF 508 FPVL QI+P P L + R F+ S+ SP++ + R LP+ F Sbjct: 441 FPVLPQIRPSTP-LNLKLRNFIISSSEDSTSPKAKE--FDRPLPSTEF 485 >SPBC4B4.01c |||fumble family pantothenate kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 403 Score = 25.8 bits (54), Expect = 6.1 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -3 Query: 685 LSILPVSGPGEISRVESN*AAGSTPGGALPSIPLSFSFATIL 560 +SIL V+GP + R+ + G T G L + + SF +L Sbjct: 214 VSILKVTGPSQFERIGGSSLGGGTLWGLLSLLTPANSFDEML 255 >SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual Length = 978 Score = 25.8 bits (54), Expect = 6.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 321 NWGHSYCDVRGEILGSSQDEHQRKHLPKVFSSIKNE 428 NW + ++G I SSQ E +L KV SI +E Sbjct: 123 NWNDFFASLQGVIAASSQSEFSNFYL-KVLLSIGDE 157 >SPBC530.15c ||SPBC661.01|spermidine family transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 516 Score = 25.4 bits (53), Expect = 8.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 519 AEPFSNVGGSLDDIFTVRTRAV 454 + P + V GS D+F+ RTR + Sbjct: 178 SSPITTVAGSFSDMFSARTRGL 199 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,878,310 Number of Sequences: 5004 Number of extensions: 59260 Number of successful extensions: 148 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 148 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -