BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00819 (708 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 2.1 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 3.7 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 3.7 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 3.7 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 22 5.0 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 5.0 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/51 (23%), Positives = 25/51 (49%) Frame = -3 Query: 169 TLTEEHRDRILILNRRFLERRLTDDMSANVSVSPRMRCTDSAAHKCNYELF 17 T+ E +R+ ++++ T DM+ +S P+ ++A N E+F Sbjct: 444 TIENEQLNRMYKSYPNYIDKE-TKDMNLEISTRPKSNTVENACVLKNTEIF 493 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = -2 Query: 344 VAIRMPPVIPINH-----YLGVLKTN 282 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = -2 Query: 344 VAIRMPPVIPINH-----YLGVLKTN 282 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = -2 Query: 344 VAIRMPPVIPINH-----YLGVLKTN 282 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 22.2 bits (45), Expect = 5.0 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 356 NSWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 478 N +VAR A F V IN+ + R+ L+ T+N Sbjct: 351 NQAVVARHDEAMIFPADVKINRGLXWIISDRMPVFLLXTLN 391 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 5.0 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 367 RRKTNISESICQRCFHQ 417 RR+ N++E++C F Q Sbjct: 966 RRRLNVNETVCSDYFSQ 982 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,068 Number of Sequences: 438 Number of extensions: 4447 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -