BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00818 (732 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomy... 30 0.39 SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pomb... 25 8.4 >SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomyces pombe|chr 1|||Manual Length = 800 Score = 29.9 bits (64), Expect = 0.39 Identities = 12/47 (25%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +1 Query: 394 YIIYLSVWICLYCAMQSHLIQTVVSKNKIYAIKIKMKIVLVIT-TPS 531 Y+I+ S ++C++ S L++T+ +++A K++ +T TP+ Sbjct: 88 YVIFQSGYVCVHDWSNSELLRTMEISTRVHAASFSGKLLFAVTDTPA 134 >SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1334 Score = 25.4 bits (53), Expect = 8.4 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -3 Query: 187 KDSVLNATLKVQSRLTKLESIPN-NNEKKVICRNQNPYLLTQTM 59 K SVL+AT+KV +T N + KK + NQ+P + + + Sbjct: 1106 KSSVLSATIKVFEPVTNYSKTRNMPSLKKFLTVNQDPLRIVKEL 1149 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,598,426 Number of Sequences: 5004 Number of extensions: 49066 Number of successful extensions: 162 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -