BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00818 (732 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against p... 24 5.6 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 9.7 >AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against programmed cell death protein. Length = 112 Score = 23.8 bits (49), Expect = 5.6 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +2 Query: 350 YSFKANSKCHL*EDIILYIFLFGFAYIVQCNLI 448 Y+ K K + + +LYI L G V C L+ Sbjct: 15 YTHKTPKKLKIVDAYLLYILLTGIMQFVYCCLV 47 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.0 bits (47), Expect = 9.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 243 ITVALREGRVPVNITCIILNYAFDAQL 323 I ALR RVP + II +Y D +L Sbjct: 583 IATALRTKRVPAGLQRIIHSYFQDREL 609 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 633,995 Number of Sequences: 2352 Number of extensions: 11854 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -