BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00818 (732 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 23 2.2 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 23 3.0 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 23 3.0 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 23 3.0 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 3.9 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 22 5.2 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 22 5.2 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 22 5.2 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 22 5.2 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 22 5.2 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 22 5.2 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 22 5.2 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 22 5.2 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 22 5.2 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 5.2 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 5.2 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 9.0 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 9.0 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 9.0 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 9.0 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 9.0 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 9.0 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = +2 Query: 182 ILRHQFDTKNEIKPFKILISNYCRVERRKSPCK 280 + ++ +TKN++ PF I N ++ + P K Sbjct: 36 VYKNNIETKNQLSPFNIDTPNRQKILKDGFPIK 68 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 160 KVQSRLTKLESIPNNNEKKVICRN 89 K+ S L+ + NNN KK+ C N Sbjct: 80 KIISSLSNNYNYNNNNYKKLYCNN 103 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 160 KVQSRLTKLESIPNNNEKKVICRN 89 K+ S L+ + NNN KK+ C N Sbjct: 80 KIISSLSNNYNYNNNNYKKLYCNN 103 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 160 KVQSRLTKLESIPNNNEKKVICRN 89 K+ S L+ + NNN KK+ C N Sbjct: 80 KIISSLSNNYNYNNNNYKKLYCNN 103 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +1 Query: 574 HEQKKKIERQNKNYEKYQRISQNELK 651 H +KKK+ + + ++Y R + E K Sbjct: 256 HNEKKKLLEERTSRKRYSRSREREQK 281 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 519 YNKNNLHFDFYGINFI 472 YNK+N + +Y IN+I Sbjct: 101 YNKHNYNKLYYNINYI 116 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 519 YNKNNLHFDFYGINFI 472 YNK+N + +Y IN+I Sbjct: 101 YNKHNYNKLYYNINYI 116 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 519 YNKNNLHFDFYGINFI 472 YNK+N + +Y IN+I Sbjct: 101 YNKHNYNKLYYNINYI 116 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 519 YNKNNLHFDFYGINFI 472 YNK+N + +Y IN+I Sbjct: 101 YNKHNYNKLYYNINYI 116 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 519 YNKNNLHFDFYGINFI 472 YNK+N + +Y IN+I Sbjct: 101 YNKHNYNKLYYNINYI 116 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 519 YNKNNLHFDFYGINFI 472 YNK+N + +Y IN+I Sbjct: 101 YNKHNYNKLYYNINYI 116 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 519 YNKNNLHFDFYGINFI 472 YNK+N + +Y IN+I Sbjct: 101 YNKHNYNKLYYNINYI 116 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 519 YNKNNLHFDFYGINFI 472 YNK+N + +Y IN+I Sbjct: 101 YNKHNYNKLYYNINYI 116 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 519 YNKNNLHFDFYGINFI 472 YNK+N + +Y IN+I Sbjct: 101 YNKHNYNKLYYNINYI 116 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 519 YNKNNLHFDFYGINFI 472 YNK+N + +Y IN+I Sbjct: 334 YNKHNYNKLYYNINYI 349 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 519 YNKNNLHFDFYGINFI 472 YNK+N + +Y IN+I Sbjct: 334 YNKHNYNKLYYNINYI 349 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 586 KKIERQNKNYEKYQRISQNELKMI 657 K I N NY+K Q + N ++ I Sbjct: 88 KTIHNNNNNYKKLQYYNINYIEQI 111 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 586 KKIERQNKNYEKYQRISQNELKMI 657 K I N NY+K Q + N ++ I Sbjct: 88 KTIHNNNNNYKKLQYYNINYIEQI 111 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 586 KKIERQNKNYEKYQRISQNELKMI 657 K I N NY+K Q + N ++ I Sbjct: 88 KTIHNNNNNYKKLQYYNINYIEQI 111 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 586 KKIERQNKNYEKYQRISQNELKMI 657 K I N NY+K Q + N ++ I Sbjct: 88 KTIHNNNNNYKKLQYYNINYIEQI 111 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 519 YNKNNLHFDFYGINFI 472 YN NN +Y IN+I Sbjct: 318 YNNNNYKKLYYNINYI 333 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 586 KKIERQNKNYEKYQRISQNELKMI 657 K I N NY+K Q + N ++ I Sbjct: 321 KTIHNNNNNYKKLQYYNINYIEQI 344 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,036 Number of Sequences: 438 Number of extensions: 4114 Number of successful extensions: 32 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -