BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00816 (787 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CY... 25 2.0 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 6.1 >AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CYP4H24 protein. Length = 193 Score = 25.4 bits (53), Expect = 2.0 Identities = 22/76 (28%), Positives = 34/76 (44%) Frame = +2 Query: 509 GPNDIIKITGRPENCEGAKKALLEQVPITIDVEVPNELHRLLAGQKRRELMPTYDVHILL 688 GP D I + NC G + ALLE + + + +R+L G E+ D+ +L Sbjct: 125 GPYDYIPFSIGSRNCIGQRYALLE---MKVAIVRMVSFYRILPGDTMHEIRLKTDL-VLR 180 Query: 689 PPNEDTSDIVKVTGTP 736 P D S +K+ P Sbjct: 181 P---DKSIPIKLVARP 193 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.8 bits (49), Expect = 6.1 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 10 TEKDEDKEAIFIMGREEQVEAARKQLETAVAEI-SNVSE 123 TEKD +++ + EE + R +LETA ++ N +E Sbjct: 518 TEKDLEEKRARLQTLEEALPVTRTELETAKQKLQENANE 556 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 809,499 Number of Sequences: 2352 Number of extensions: 16998 Number of successful extensions: 44 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -