BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00813 (748 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 4.5 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 4.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 6.0 AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 21 7.9 AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esteras... 21 7.9 AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esteras... 21 7.9 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 22.2 bits (45), Expect = 4.5 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -1 Query: 457 FLLFVLSLFYTKA*VFCLSIEALRSLPGQPV 365 FLLF L Y S+ +L LPG PV Sbjct: 14 FLLFYLFYCYKTIKQHIYSLISLSYLPGPPV 44 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 22.2 bits (45), Expect = 4.5 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -1 Query: 457 FLLFVLSLFYTKA*VFCLSIEALRSLPGQPV 365 FLLF L Y S+ +L LPG PV Sbjct: 14 FLLFYLFYCYKTIKQHIYSLISLSYLPGPPV 44 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +2 Query: 479 QRKNKIVIFINSEHFHIYLPFKPSLDFH 562 QR +V FIN + F + +P D H Sbjct: 351 QRLGSLVDFINLQAFDFHREREPVADHH 378 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = +1 Query: 274 YEKSKGQFRKLGCYNKKTIVK*KDDFNSY 360 + KS+G + YN + + + D++N Y Sbjct: 319 FTKSEGLYHLDEVYNNQLLTRLDDNWNKY 347 >AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = +1 Query: 274 YEKSKGQFRKLGCYNKKTIVK*KDDFNSY 360 + KS+G + YN + + + D++N Y Sbjct: 319 FTKSEGLYHLDEVYNNQLLTRLDDNWNKY 347 >AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = +1 Query: 274 YEKSKGQFRKLGCYNKKTIVK*KDDFNSY 360 + KS+G + YN + + + D++N Y Sbjct: 319 FTKSEGLYHLDEVYNNQLLTRLDDNWNKY 347 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,675 Number of Sequences: 336 Number of extensions: 3334 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -