BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00812 (746 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44986| Best HMM Match : Ion_trans_2 (HMM E-Value=6.9e-15) 31 0.75 SB_39225| Best HMM Match : NIF (HMM E-Value=0) 28 9.2 >SB_44986| Best HMM Match : Ion_trans_2 (HMM E-Value=6.9e-15) Length = 711 Score = 31.5 bits (68), Expect = 0.75 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +2 Query: 137 IDCTHPAEDSILDVGNFEKYL--KEHVKVEGKTNNLSNHVV 253 + C H +E S L + + Y K KVE NNLSNHV+ Sbjct: 376 LPCVHSSETSELFAQDLKMYYVQKAFSKVEPMLNNLSNHVI 416 >SB_39225| Best HMM Match : NIF (HMM E-Value=0) Length = 1772 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -3 Query: 366 RKYSNKVTTDFILVSMHPILLFSCT 292 R S+ +TD ++ S+HP+L FS T Sbjct: 1628 RSESSSSSTDVLMASIHPLLSFSST 1652 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,026,508 Number of Sequences: 59808 Number of extensions: 362037 Number of successful extensions: 698 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 697 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -