BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00812 (746 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58760-2|AAK31460.1| 130|Caenorhabditis elegans Ribosomal prote... 48 7e-06 >U58760-2|AAK31460.1| 130|Caenorhabditis elegans Ribosomal protein, large subunitprotein 22, isoform a protein. Length = 130 Score = 48.0 bits (109), Expect = 7e-06 Identities = 20/54 (37%), Positives = 34/54 (62%) Frame = +2 Query: 122 NLKFTIDCTHPAEDSILDVGNFEKYLKEHVKVEGKTNNLSNHVVAPGIRRKSLS 283 +LKF ++C +P ED IL + + E +L E +KV GKT +L+ + V + + +S Sbjct: 20 HLKFNVECKNPVEDGILRIEDLEAFLNEKIKVNGKTGHLAANNVKVEVAKSKVS 73 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,123,415 Number of Sequences: 27780 Number of extensions: 282498 Number of successful extensions: 620 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 620 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1766990064 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -