BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= wdS00810
(775 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
07_03_0632 - 20112297-20116562 31 1.0
>07_03_0632 - 20112297-20116562
Length = 1421
Score = 31.1 bits (67), Expect = 1.0
Identities = 16/65 (24%), Positives = 33/65 (50%)
Frame = -1
Query: 637 SFKILEIIFFENVNGFQTNNQTVNEKQ*AN*FHLELNFSEEIIT*PIXXXXXXXXLSTIT 458
+FK LEI+ FE++ + + NE+ +N +L++N + + P+ ++T
Sbjct: 1003 AFKSLEILCFESMGKLENWADSQNEESFSNLQNLQINRCDNLRELPLMSLGLAIRKLSLT 1062
Query: 457 GCSRF 443
GC +
Sbjct: 1063 GCGSY 1067
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,136,834
Number of Sequences: 37544
Number of extensions: 330903
Number of successful extensions: 583
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 578
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 583
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2068401984
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -