BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00810 (775 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18036| Best HMM Match : DUF29 (HMM E-Value=8) 31 1.4 SB_15898| Best HMM Match : Fork_head (HMM E-Value=0) 28 7.3 >SB_18036| Best HMM Match : DUF29 (HMM E-Value=8) Length = 125 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 5/47 (10%) Frame = -3 Query: 512 HNITYI---VVPSAATIKYYHGLQSFY--VQKHIAGMHASNRNGARQ 387 HNIT+ ++P A + H LQS+Y + KH+ +H +N RQ Sbjct: 28 HNITWPYTGIIPRDAQASFQHLLQSYYKTLAKHLLQVHKDLQNRERQ 74 >SB_15898| Best HMM Match : Fork_head (HMM E-Value=0) Length = 460 Score = 28.3 bits (60), Expect = 7.3 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = -2 Query: 252 DTKQQQYIRSRPPYVYANLIRNTF*LTLYVIPKTSVSICS**YCLNYDFIKPQGH 88 + +Q Q S+PPY YANLI TF + K ++S C ++ + K G+ Sbjct: 63 EARQHQTKESKPPYSYANLI--TFAINSSPEKKMTLSEIYQWICDHFPYYKEAGN 115 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,497,037 Number of Sequences: 59808 Number of extensions: 444163 Number of successful extensions: 742 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 739 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2107953584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -