BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00808 (772 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 2.0 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 6.2 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 6.2 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 22 6.2 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 6.2 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 632 RQRSFSQRISERIRKSHKSQS 694 RQ+ F E IR++HKS S Sbjct: 232 RQKRFKDEKKELIRQTHKSPS 252 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.8 bits (44), Expect = 6.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 531 RDYIHVMDLASGHVAALNLLSQTHIRLKVYN 623 R Y + L + H+AA N+LS L + N Sbjct: 71 RLYYPIYKLNAAHLAAANILSPEDCELVLSN 101 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 21.8 bits (44), Expect = 6.2 Identities = 10/44 (22%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +1 Query: 439 LMPF-LAQVALGKKPVLTVFGTDYTLPMELVFEITYTSWIWLAG 567 L+PF + + + P + T +E+ FE+ + +W+ G Sbjct: 53 LLPFAIYHIFMHIVPTKLISFYKSTAILEIAFEVIFIVTVWMTG 96 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 642 VSVKELVNVFERVTKAKVP 698 +SV+ +NVF+R+ K P Sbjct: 401 ISVETKLNVFKRIGNIKAP 419 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.8 bits (44), Expect = 6.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 531 RDYIHVMDLASGHVAALNLLSQTHIRLKVYN 623 R Y + L + H+AA N+LS L + N Sbjct: 71 RLYYPIYKLNAAHLAAANILSPEDCELVLSN 101 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,121 Number of Sequences: 336 Number of extensions: 4464 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20753800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -