BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00807 (760 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 24 1.1 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 23 2.0 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 8.1 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.1 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 688 VQAKKALNPVITKIEMVGGW 629 V+A K +NP + I +GGW Sbjct: 86 VEALKEINPNLKTIISIGGW 105 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 218 YLHTYNLCKLQYFCQASPWCVILILIAIVLT 126 YL Y+ K + FC+ + +I I + +LT Sbjct: 25 YLKIYHKEKYRKFCRILKYFIIAIYVLTILT 55 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -1 Query: 688 VQAKKALNPVITKIEMVGGW 629 +Q K NP + + +GGW Sbjct: 151 IQKLKKANPSLKTLLAIGGW 170 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = -2 Query: 192 VTILLSGIALVCHSHIDSHCTY 127 V +LLSG+ +C + C++ Sbjct: 170 VPVLLSGLIAMCGMYYRDECSF 191 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = -2 Query: 192 VTILLSGIALVCHSHIDSHCTY 127 V +LLSG+ +C + C++ Sbjct: 403 VPVLLSGLIAMCGMYYRDECSF 424 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = -2 Query: 192 VTILLSGIALVCHSHIDSHCTY 127 V +LLSG+ +C + C++ Sbjct: 403 VPVLLSGLIAMCGMYYRDECSF 424 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,986 Number of Sequences: 336 Number of extensions: 4403 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -