BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00807 (760 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002196-4|AAB53979.1| 198|Caenorhabditis elegans Ribosomal pro... 61 1e-09 AC024751-9|AAK21508.2| 677|Caenorhabditis elegans Pif1p dna hel... 29 2.7 AB015041-1|BAA28677.1| 677|Caenorhabditis elegans PIF1 protein. 29 2.7 >AF002196-4|AAB53979.1| 198|Caenorhabditis elegans Ribosomal protein, large subunitprotein 19 protein. Length = 198 Score = 60.9 bits (141), Expect = 1e-09 Identities = 24/37 (64%), Positives = 34/37 (91%) Frame = +3 Query: 15 MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNS 125 MS+L+LQKRLA++V++CGK +VWLDPNE++EI+ NS Sbjct: 1 MSNLRLQKRLASAVLKCGKHRVWLDPNEVSEISGANS 37 >AC024751-9|AAK21508.2| 677|Caenorhabditis elegans Pif1p dna helicase (yeast) homologprotein 1 protein. Length = 677 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 102 NEIANTNSSKYNGYQYENDTPGRCLTEVL 188 ++I + G++YEN TP +CL +VL Sbjct: 301 SQIGGITLHAFCGFRYENSTPEQCLKQVL 329 >AB015041-1|BAA28677.1| 677|Caenorhabditis elegans PIF1 protein. Length = 677 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 102 NEIANTNSSKYNGYQYENDTPGRCLTEVL 188 ++I + G++YEN TP +CL +VL Sbjct: 301 SQIGGITLHAFCGFRYENSTPEQCLKQVL 329 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,743,929 Number of Sequences: 27780 Number of extensions: 373713 Number of successful extensions: 946 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 946 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1809061256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -