BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00806 (740 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC019582-1|AAH19582.1| 465|Homo sapiens tRNA splicing endonucle... 40 0.007 BC004211-1|AAH04211.1| 465|Homo sapiens TSEN2 protein protein. 40 0.007 BC004178-1|AAH04178.1| 465|Homo sapiens TSEN2 protein protein. 40 0.007 AK074794-1|BAC11213.1| 439|Homo sapiens protein ( Homo sapiens ... 40 0.007 >BC019582-1|AAH19582.1| 465|Homo sapiens tRNA splicing endonuclease 2 homolog (S. cerevisiae) protein. Length = 465 Score = 40.3 bits (90), Expect = 0.007 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +3 Query: 378 IFTGYYNGYNVEVRSPEEITLLYHMGCFGKGSASRSRPALVNSD 509 IF NV VR+ E+I LY G FGKG SRSRP+ SD Sbjct: 39 IFRAEMINNNVIVRNAEDIEQLYGKGYFGKGILSRSRPSFTISD 82 >BC004211-1|AAH04211.1| 465|Homo sapiens TSEN2 protein protein. Length = 465 Score = 40.3 bits (90), Expect = 0.007 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +3 Query: 378 IFTGYYNGYNVEVRSPEEITLLYHMGCFGKGSASRSRPALVNSD 509 IF NV VR+ E+I LY G FGKG SRSRP+ SD Sbjct: 39 IFRAEMINNNVIVRNAEDIEQLYGKGYFGKGILSRSRPSFTISD 82 >BC004178-1|AAH04178.1| 465|Homo sapiens TSEN2 protein protein. Length = 465 Score = 40.3 bits (90), Expect = 0.007 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +3 Query: 378 IFTGYYNGYNVEVRSPEEITLLYHMGCFGKGSASRSRPALVNSD 509 IF NV VR+ E+I LY G FGKG SRSRP+ SD Sbjct: 39 IFRAEMINNNVIVRNAEDIEQLYGKGYFGKGILSRSRPSFTISD 82 >AK074794-1|BAC11213.1| 439|Homo sapiens protein ( Homo sapiens cDNA FLJ90313 fis, clone NT2RP2001388, weakly similar to TRNA-SPLICING ENDONUCLEASE SUBUNIT SEN2 (EC 3.1.27.9). ). Length = 439 Score = 40.3 bits (90), Expect = 0.007 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +3 Query: 378 IFTGYYNGYNVEVRSPEEITLLYHMGCFGKGSASRSRPALVNSD 509 IF NV VR+ E+I LY G FGKG SRSRP+ SD Sbjct: 39 IFRAEMINNNVIVRNAEDIEQLYGKGYFGKGILSRSRPSFTISD 82 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,894,111 Number of Sequences: 237096 Number of extensions: 2145542 Number of successful extensions: 3874 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3874 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8847149012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -