BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00806 (740 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 24 1.7 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 9.2 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 9.2 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 635 KIVSDGEKLTKKDIIDLVSSDEE 703 K++SDG +KD I + DEE Sbjct: 69 KLLSDGLMCVEKDSIHSIDGDEE 91 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 9.2 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -3 Query: 573 PNFLYQLFLCKYCLFLIISG*RHCLQVRVVTSRQ 472 P F + F YC +G CL+V ++ R+ Sbjct: 207 PRFTLEKFFTDYCNSKTNTGEYSCLKVDLLFKRE 240 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 9.2 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -3 Query: 573 PNFLYQLFLCKYCLFLIISG*RHCLQVRVVTSRQ 472 P F + F YC +G CL+V ++ R+ Sbjct: 207 PRFTLEKFFTDYCNSKTNTGEYSCLKVDLLFKRE 240 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,296 Number of Sequences: 438 Number of extensions: 4765 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -