Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00803
         (774 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase pro...    24   1.4  
AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cycl...    23   4.2  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    22   5.5  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    22   5.5  
AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    22   7.3  

>AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase
           protein.
          Length = 580

 Score = 24.2 bits (50), Expect = 1.4
 Identities = 7/16 (43%), Positives = 10/16 (62%)
 Frame = -2

Query: 740 WGRWWCWSESRRPFQL 693
           WG  W W+E R+ + L
Sbjct: 169 WGSAWQWNEERKQYYL 184


>AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cyclase
           beta-3 protein.
          Length = 832

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 12/33 (36%), Positives = 14/33 (42%), Gaps = 1/33 (3%)
 Frame = -1

Query: 471 HCADSPELFT*RMFHLLL-NFQSCLHMGHCC*G 376
           HC    E +    FH  + N QS  H   CC G
Sbjct: 782 HCEKGKEYYA-ASFHTDIGNSQSLAHQDQCCPG 813


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +1

Query: 673 PWRRGGDSWNGR 708
           PWR  G+ WN R
Sbjct: 135 PWRTCGNPWNTR 146


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +1

Query: 673 PWRRGGDSWNGR 708
           PWR  G+ WN R
Sbjct: 188 PWRTCGNPWNTR 199


>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 21.8 bits (44), Expect = 7.3
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +1

Query: 727 HHRPHPYTTSG 759
           HH PHP  T G
Sbjct: 464 HHHPHPPETPG 474


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 195,529
Number of Sequences: 438
Number of extensions: 4234
Number of successful extensions: 8
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24275400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)