BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00802 (699 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 27 0.23 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 27 0.23 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 8.5 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 26.6 bits (56), Expect = 0.23 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +3 Query: 117 HGYRPRTETNLPRSWTISSHRPERPNNQTSIRPPI 221 HGYR RT L R +SS R + + PP+ Sbjct: 205 HGYRCRTMHRLTRQVVVSSVANVRIADHRGVMPPV 239 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +1 Query: 412 ITQSKTETIPPATKDATATTSRPTKHYTIRPIVE 513 I Q + T PP A +P YTIR I E Sbjct: 952 IWQQQEFTGPPLPYAALIDELKPATRYTIRVIAE 985 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 26.6 bits (56), Expect = 0.23 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +3 Query: 117 HGYRPRTETNLPRSWTISSHRPERPNNQTSIRPPI 221 HGYR RT L R +SS R + + PP+ Sbjct: 205 HGYRCRTMHRLTRQVVVSSVANVRIADHRGVMPPV 239 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +1 Query: 412 ITQSKTETIPPATKDATATTSRPTKHYTIRPIVE 513 I Q + T PP A +P YTIR I E Sbjct: 948 IWQQQEFTGPPLPYAALIDELKPATRYTIRVIAE 981 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 671 TSVRGSRLVCYVRRRSSNFR 612 +SVR S ++C +RS FR Sbjct: 346 SSVRDSSIICGGNKRSQVFR 365 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,511 Number of Sequences: 438 Number of extensions: 3755 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -