BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00800 (717 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17519| Best HMM Match : HLH (HMM E-Value=6e-08) 37 0.019 SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) 31 0.93 SB_39365| Best HMM Match : HLH (HMM E-Value=5.5e-07) 31 1.2 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_24991| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_8854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_38173| Best HMM Match : PAN (HMM E-Value=0.0013) 28 8.7 SB_10793| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 >SB_17519| Best HMM Match : HLH (HMM E-Value=6e-08) Length = 125 Score = 36.7 bits (81), Expect = 0.019 Identities = 21/63 (33%), Positives = 39/63 (61%) Frame = +1 Query: 67 KAITAVCATGASVPAIASGRVQRHRDGENAEIQMYLSKLQDLVPFMPKNRKISKLEVIQH 246 +A+ A + +S+ AS + RD + + Y +L+++VP +P R+ISK+E++Q+ Sbjct: 14 EALRATIRSASSITR-ASIFSEFERDSNDNMSECY-ERLKNMVPNVPVGRRISKVEILQY 71 Query: 247 VID 255 VID Sbjct: 72 VID 74 >SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) Length = 374 Score = 31.1 bits (67), Expect = 0.93 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 408 SANHPPHTNTEIKRHQKNKTNLTGRRVKCNL 500 SA H P E K+H++ K +L GR++K L Sbjct: 318 SAKHLPQKKPESKKHEQTKKDLKGRKLKRQL 348 >SB_39365| Best HMM Match : HLH (HMM E-Value=5.5e-07) Length = 105 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/55 (32%), Positives = 29/55 (52%) Frame = +1 Query: 127 VQRHRDGENAEIQMYLSKLQDLVPFMPKNRKISKLEVIQHVIDISATFNQRWRIT 291 + R R E A I+ L+ L L+P NRK+SK ++Q I+ + + + IT Sbjct: 41 ISRQRKREYA-IREALNHLNSLLPLDNPNRKLSKNMILQTAIEYIRSLQEEFNIT 94 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 364 SEETARPSPYAQHHPPQITLHTRTQKSNGTRKTKP 468 S+E +RPSP+A Q + RT N K+ P Sbjct: 110 SQEQSRPSPFASQEHNQTSPFARTMDDNAPSKSSP 144 >SB_24991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1146 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Frame = +2 Query: 524 INKYTSKRPALPWEAPDA-----WENRSLPNFSSSEDHLSMISYVRSRYDQYMY 670 I ++TSK P L + PD + ++ ++ E + + Y ++DQY+Y Sbjct: 651 IKEFTSKAPVLKYYEPDVELTVQCDAKTEQRYAQIEKEMLAVVYSLQKFDQYVY 704 >SB_8854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 339 Score = 28.3 bits (60), Expect = 6.6 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = -2 Query: 194 TRSWSFERYICI-SAFSPSRC-RCTRPLAIA 108 TRSW+F+R++ I + P +C +C + A+A Sbjct: 149 TRSWNFQRHVLIHTGQKPYKCQKCPKAFALA 179 >SB_38173| Best HMM Match : PAN (HMM E-Value=0.0013) Length = 340 Score = 27.9 bits (59), Expect = 8.7 Identities = 17/69 (24%), Positives = 25/69 (36%) Frame = +2 Query: 413 KSPSTHEHRNQTAPEKQNQPDRPSC*MQPRLRLFMVNINKYTSKRPALPWEAPDAWENRS 592 KS + T K +P +P+ +P K T +P P PD N Sbjct: 172 KSTKATKSTKPTKSTKPTKPTKPTKSTKPTKSTKPTKSTKPTESKPTAPTSLPDQRPNCR 231 Query: 593 LPNFSSSED 619 LP+ + D Sbjct: 232 LPSMPLNPD 240 >SB_10793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = +1 Query: 367 EETARPSPYA----QHHPPQITLHTRTQKSNGTRKTK 465 ++ P+P+ QHH P+ T HT Q ++ T +TK Sbjct: 340 DQGTHPTPWTRVHIQHHGPRYTSHTMDQGTHPTIRTK 376 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,704,456 Number of Sequences: 59808 Number of extensions: 426084 Number of successful extensions: 1382 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1173 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1376 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -