BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00799 (771 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 26 0.34 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 26 0.34 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.5 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 9.6 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 26.2 bits (55), Expect = 0.34 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -2 Query: 527 KVAGILLELRRHDKGVLLRSERANLCLYRVELNQVQFTPFGDSPQR--VLHFR 375 K+ G+ + +D+GV ++ N+ ++V+F GD R +L+FR Sbjct: 354 KLKGLCPSMANYDRGVFYKNYLLNVSFIDAAGSEVKFDEHGDGLARYEILNFR 406 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 26.2 bits (55), Expect = 0.34 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -2 Query: 527 KVAGILLELRRHDKGVLLRSERANLCLYRVELNQVQFTPFGDSPQR--VLHFR 375 K+ G+ + +D+GV ++ N+ ++V+F GD R +L+FR Sbjct: 444 KLKGLCPSMANYDRGVFYKNYLLNVSFIDAAGSEVKFDEHGDGLARYEILNFR 496 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +1 Query: 613 QNAGSPLTERRCFTPGQRL 669 + G+P R C TP +RL Sbjct: 137 RTCGNPWNTRYCLTPTERL 155 Score = 22.2 bits (45), Expect = 5.5 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -3 Query: 691 GLVLYKAKVFVQA*STFALLRDSQHFGRQLGFAFQMTPKL 572 G V+Y +F A T L+R G G + +TP L Sbjct: 232 GKVVYFTSLFPYALLTILLIRGLTLPGAMEGLKYYVTPNL 271 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +1 Query: 613 QNAGSPLTERRCFTPGQRL 669 + G+P R C TP +RL Sbjct: 190 RTCGNPWNTRYCLTPTERL 208 Score = 22.2 bits (45), Expect = 5.5 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -3 Query: 691 GLVLYKAKVFVQA*STFALLRDSQHFGRQLGFAFQMTPKL 572 G V+Y +F A T L+R G G + +TP L Sbjct: 285 GKVVYFTSLFPYALLTILLIRGLTLPGAMEGLKYYVTPNL 324 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 351 QERRSKLVSEVENSLGRVSEW 413 QER S+LV +EN V W Sbjct: 465 QERESELVPYLENKGNGVYAW 485 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 239,186 Number of Sequences: 438 Number of extensions: 5343 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -