BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00798 (749 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9SST0 Cluster: Putative uncharacterized protein AT4g09... 35 1.9 UniRef50_Q83944 Cluster: 2a protein; n=1; Olive latent virus 2|R... 33 5.7 >UniRef50_Q9SST0 Cluster: Putative uncharacterized protein AT4g09640; n=2; Arabidopsis thaliana|Rep: Putative uncharacterized protein AT4g09640 - Arabidopsis thaliana (Mouse-ear cress) Length = 339 Score = 35.1 bits (77), Expect = 1.9 Identities = 20/71 (28%), Positives = 32/71 (45%) Frame = -3 Query: 675 WWCHPCTLTRGPITNNYVNYNFAGLIFIT*CYSFTMEVNCEHLISTHFIRIIGTRLDPNT 496 WW T+ G I N + Y FA I +T + ++ + CE H I+G L Sbjct: 67 WWIGMITMIVGEIAN-FAAYAFAPAILVTPLGALSIIIRCEQTQKLHTFGILGCALCIVG 125 Query: 495 SALLNMNAPDD 463 S + ++AP + Sbjct: 126 SVTIVLHAPQE 136 >UniRef50_Q83944 Cluster: 2a protein; n=1; Olive latent virus 2|Rep: 2a protein - Olive latent virus 2 Length = 787 Score = 33.5 bits (73), Expect = 5.7 Identities = 15/60 (25%), Positives = 22/60 (36%) Frame = +1 Query: 478 HVEQCTGVRIQAGTNYSNEMRTYQMFTIDFHGEGITSCNKNQTCKVIIYIIIGDRTSCEC 657 H E C G + G S +Y ++ G G+ + C Y + R SC C Sbjct: 65 HAECCEGPLMNKGLTLSTYFMSYPGISLPAFGGGVIHVTSARVCMQAFYAVTPGRCSCSC 124 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 656,706,800 Number of Sequences: 1657284 Number of extensions: 12527334 Number of successful extensions: 28065 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28055 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 61734884250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -