BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00798 (749 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0322 - 8938101-8938149,8938235-8938458,8938545-8938605,893... 31 1.3 01_01_1106 + 8750597-8754031 28 9.1 >02_02_0322 - 8938101-8938149,8938235-8938458,8938545-8938605, 8938724-8940761,8940797-8940908,8942037-8942047, 8942293-8942443 Length = 881 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +2 Query: 644 PLVSVH--GWHHHPACFCREAVMRFGLKDGGIPCNYN 748 PL+S H G++H PAC C R L G P +N Sbjct: 387 PLISYHHDGFYHQPACSCLHCYHREFLPVQGPPLGFN 423 >01_01_1106 + 8750597-8754031 Length = 1144 Score = 27.9 bits (59), Expect = 9.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 304 KIEQLSQKIDIIVAGKKKNLINKGMSGR*MLLWNV 408 +IE S K+D+ A K+ N NK + LLW + Sbjct: 788 RIECWSHKMDLTTAAKRANWRNKKKLSKLTLLWTI 822 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,370,766 Number of Sequences: 37544 Number of extensions: 332499 Number of successful extensions: 766 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 766 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -