BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00795 (703 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 29 0.19 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 26 1.3 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 25 1.7 EF519472-1|ABP73553.1| 165|Anopheles gambiae CTLMA2 protein. 25 2.3 EF519475-1|ABP73559.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.0 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 3.0 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 5.3 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 7.0 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 7.0 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 23 9.3 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 9.3 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 28.7 bits (61), Expect = 0.19 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = -2 Query: 609 TQFLDGHVLYVETYIVSRYSFLESFVVHLHRFDLVVMLAGAKTTMVPGFNTPVSTL 442 T LDG+ I S SF+ +++V L +F L ++ AK + +S + Sbjct: 402 TMNLDGYANINRGLITSNISFMATYLVVLMQFKLTLLRQSAKNAFISALKANLSRI 457 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 25.8 bits (54), Expect = 1.3 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 206 SWVVANLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 90 ++V+AN L V FLL K L + W+ + S+DE Sbjct: 927 AFVMANALFVLVIFLLQLKKQELHIEWWFNVKNKISFDE 965 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 25.4 bits (53), Expect = 1.7 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -2 Query: 489 AKTTMVPGFNTPVSTLPTGTVPIPPILYTSCRG 391 A T PG P+S L G V P YT+ G Sbjct: 450 ATLTPSPGIGGPISPLDPGNVTPTPPAYTTLGG 482 >EF519472-1|ABP73553.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 25.0 bits (52), Expect = 2.3 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 378 SPCVFPCKTYTKSVVLVP 431 +PC+ PCK + + V +P Sbjct: 23 NPCLCPCKPFEEKVYFIP 40 >EF519475-1|ABP73559.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 339 LSMPSCHLPAPLTSPCVFPCKTYTKSVVLVP 431 LS P P +PC+ PCK + + +P Sbjct: 10 LSGPHTVDDIPQQNPCLCPCKPFEEKEYFIP 40 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 3.0 Identities = 14/49 (28%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 312 KLTENASLKLSMPSCHLPAP--LTSPCVFPCKTYTKSVVLVPCPSAELK 452 +L + L +PSC LP P + P P KS C + L+ Sbjct: 90 ELVTRSLSNLELPSCRLPCPNLIPRPAEVPTTPEHKSAASSSCSLSTLE 138 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.8 bits (49), Expect = 5.3 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 Query: 356 PPARPTDKPLRLP 394 P +RPT KP RLP Sbjct: 289 PRSRPTSKPKRLP 301 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +3 Query: 126 PPYSEPRFEEIKKEVSSYIKKIGYNPAAVAF 218 PP+S +KK+ Y+++ N +A F Sbjct: 333 PPWSNRTLRNLKKDRMKYLRRYRLNRSAFNF 363 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = -3 Query: 470 LVSTHQFQLCRRARYQYHRFCIRLAGEDAGACQWGGQVAGWHR 342 + T+ +LC +Q H RL G G+ G +HR Sbjct: 191 ITRTNAERLCSSLLHQAHELRPRLKGGGPGSALLNGSFRVYHR 233 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 23.0 bits (47), Expect = 9.3 Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +3 Query: 150 EEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLSLQPKCLGSRDG-RWSVKK 308 EE+K+E+ GY P +A G+N L ++ DG + VKK Sbjct: 906 EEVKEELGRERNNAGYTPLQLADAKSHTGQGNNKLIVRELLRHYPDGLQKEVKK 959 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 9.3 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Frame = +1 Query: 106 TKWIPLNHHTVSPDLRKSRRK----YPHTSRRLATTQLLSLS 219 T ++ L+HH + PD+ K+ + + T AT +L+++S Sbjct: 822 TLFMALDHHDMDPDMEKALKSGNYFFTATFAIEATMKLIAMS 863 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 846,529 Number of Sequences: 2352 Number of extensions: 20197 Number of successful extensions: 83 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -