BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00793 (797 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0786 - 5881178-5881303,5881523-5881627,5882078-5882169,588... 28 7.5 10_05_0012 + 7874326-7874831,7929715-7931393,7931508-7933396 28 9.9 02_02_0537 + 11308195-11309667 28 9.9 01_05_0645 - 23899579-23904483 28 9.9 >06_01_0786 - 5881178-5881303,5881523-5881627,5882078-5882169, 5882267-5882336,5882639-5882724,5882916-5883017, 5883375-5883597,5883693-5883758,5883896-5883986, 5884019-5884057,5885401-5885548,5885623-5885715, 5885782-5885886,5886645-5886826,5886912-5887084 Length = 566 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +1 Query: 244 HTGRGRSHSAPPVFIYTLGVGQTRPCGKLDALIQFWVIFGYS 369 H +G S PP+ + T G G LD +Q+W G++ Sbjct: 356 HIFQGSSDEKPPLLVRTHGGPTDEARGVLDLGVQYWTSRGWA 397 >10_05_0012 + 7874326-7874831,7929715-7931393,7931508-7933396 Length = 1357 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 607 ILHRHPNGLPTLQ*RLTQPVLNCLFCCYRNT 699 ILH HPN TQP C C Y+++ Sbjct: 1015 ILHNHPNSFLPQYILRTQPKAPCRSCAYKDS 1045 >02_02_0537 + 11308195-11309667 Length = 490 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 607 ILHRHPNGLPTLQ*RLTQPVLNCLFCCYRNT 699 ILH HPN TQP C C Y+++ Sbjct: 173 ILHNHPNSFLPQYILRTQPKAPCRSCAYKDS 203 >01_05_0645 - 23899579-23904483 Length = 1634 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 607 ILHRHPNGLPTLQ*RLTQPVLNCLFCCYRNT 699 ILH HPN TQP C C Y+++ Sbjct: 1292 ILHNHPNSFLPQYILRTQPKAPCRSCAYKDS 1322 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,761,696 Number of Sequences: 37544 Number of extensions: 490478 Number of successful extensions: 1166 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1166 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2162420256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -