BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00793 (797 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g12290.1 68418.m01445 expressed protein similarity to NCA2 pr... 30 2.0 At3g50760.1 68416.m05558 glycosyl transferase family 8 protein c... 29 4.7 At1g43680.1 68414.m05018 hypothetical protein 28 8.3 >At5g12290.1 68418.m01445 expressed protein similarity to NCA2 protein, yeast, PIR:S54389~Contains 'Homeobox' domain signature and profile AA305-328 Length = 602 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 126 FRLWVLKHGQLMTSSEVSAGWSHSASSLICS 218 F +W+L+H LM SS++ W H A S Sbjct: 315 FSIWLLRHSSLMGSSDIE-NWVHDAKEATMS 344 >At3g50760.1 68416.m05558 glycosyl transferase family 8 protein contains Pfam profile: PF01501 Glycosyl transferase family 8 Length = 285 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 283 KPEARSESG-PAQCDRVWVPYEVEQMRLD 200 KP R + G P D +WVPY++ + R D Sbjct: 253 KPWVRLDDGRPCPLDALWVPYDLLESRFD 281 >At1g43680.1 68414.m05018 hypothetical protein Length = 247 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -1 Query: 434 NLFINWIKYNNTKNSRV-LFS-LHEYPKITQN*IRASNFPH 318 N W + N++NS + +S LH++P ++ N A N PH Sbjct: 135 NSLNRWDQEINSQNSNISTYSPLHDFPVVSWNFYTAGNLPH 175 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,621,853 Number of Sequences: 28952 Number of extensions: 403114 Number of successful extensions: 882 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -