BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00792 (739 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ... 31 1.1 At5g49060.1 68418.m06070 DNAJ heat shock N-terminal domain-conta... 30 1.4 At4g29700.1 68417.m04230 type I phosphodiesterase/nucleotide pyr... 30 1.4 At5g45190.1 68418.m05547 cyclin family protein similar to cyclin... 29 3.2 At1g10760.1 68414.m01231 starch excess protein (SEX1) identical ... 29 3.2 At5g59510.1 68418.m07458 expressed protein 29 4.3 At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless... 28 7.4 At3g07980.1 68416.m00975 protein kinase, putative similar to MAP... 28 7.4 At3g07400.1 68416.m00882 lipase class 3 family protein contains ... 27 9.8 At1g74800.1 68414.m08666 galactosyltransferase family protein co... 27 9.8 >At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1368 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -3 Query: 653 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELN 537 D +G G+YG N +V + +SLE IV E+LN Sbjct: 24 DEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIVQEDLN 62 >At5g49060.1 68418.m06070 DNAJ heat shock N-terminal domain-containing protein low similarity to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 354 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 153 FFDHFD-FDAFNTVYFSKEELKSSPHGYKVRQPR 251 F D FD + F TV+ + E+ + H Y+ RQPR Sbjct: 189 FDDEFDPEEIFRTVFGQQREVFRASHAYRTRQPR 222 >At4g29700.1 68417.m04230 type I phosphodiesterase/nucleotide pyrophosphatase family protein similar to SP|P22413 Ectonucleotide pyrophosphatase/phosphodiesterase 1 (Plasma-cell membrane glycoprotein PC-1) [Includes: Alkaline phosphodiesterase I (EC 3.1.4.1); Nucleotide pyrophosphatase (EC 3.6.1.9) {Homo sapiens}; contains Pfam profile PF01663: Type I phosphodiesterase / nucleotide pyrophosphatase Length = 461 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +3 Query: 132 KVDKMVTFFDHFDFDAFNTVYFSKEELKSSPHGYKVRQPRLTTSRS 269 +VD +++ FDH + + + + +E S H Y PR+TT+ S Sbjct: 194 RVDSVLSHFDHLEDEVPDLLMLYFDEPDQSGHNYGPDDPRVTTAVS 239 >At5g45190.1 68418.m05547 cyclin family protein similar to cyclin T1 [Equus caballus] GI:5052355; contains Pfam profile PF00134: Cyclin, N-terminal domain Length = 579 Score = 29.1 bits (62), Expect = 3.2 Identities = 28/81 (34%), Positives = 37/81 (45%), Gaps = 6/81 (7%) Frame = +2 Query: 212 QELSSRLQGPSTTSY------HKPFTVTIDIKSDVATNAVVKMFLGPKYDENGFPFSLED 373 Q+L RL+ P T H+ F K+D T A V MFL K +E P L+D Sbjct: 68 QDLGMRLKVPQVTIATAIIFCHRFFFRQSHAKNDRRTIATVCMFLAGKVEET--PRPLKD 125 Query: 374 NWMNFYELDWFVQKVNPGQSQ 436 YE+ + K +PG SQ Sbjct: 126 VIFVSYEI---INKKDPGASQ 143 >At1g10760.1 68414.m01231 starch excess protein (SEX1) identical to SEX1 [Arabidopsis thaliana] GI:12044358; supporting cDNA gi|12044357|gb|AF312027.1|AF312027 Length = 1399 Score = 29.1 bits (62), Expect = 3.2 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = -3 Query: 674 TTDLNGSDSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELNMSV 528 T+DL G+ S +G Y SW G P+ V L E ++SE+ N +V Sbjct: 1089 TSDLVGAKSRNIG-YLKGKVPSWVGIPTSVALPFGVFEKVISEKANQAV 1136 >At5g59510.1 68418.m07458 expressed protein Length = 144 Score = 28.7 bits (61), Expect = 4.3 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = +1 Query: 13 TQPSTSSIKELFNTSSNLNSTRYHTHKKLFTSLV*KFPTSKSTKWSHSLTISTSMP-STL 189 T+ S+SS K +F S + T Y + + +F PTS + + S + ST P T Sbjct: 33 TKTSSSSSKPVFTRSFSTKPTSYSSSEPIFRRSFSAKPTSSKSPFL-SRSGSTKCPVDTS 91 Query: 190 STSVKKNSRAL 222 STS SR+L Sbjct: 92 STSKCSISRSL 102 >At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless protein, putative similar to notchless [Xenopus laevis] GI:3687833; contains Pfam PF00400: WD domain, G-beta repeat (8 copies) Length = 473 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 477 TLYRWPKSTSSGPRKDSY*HVQLLGHYAFEAD 572 T++ W S S P+K H QL+ H F D Sbjct: 340 TMFLWEPSVSKQPKKRLTGHQQLVNHVYFSPD 371 >At3g07980.1 68416.m00975 protein kinase, putative similar to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1367 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -3 Query: 653 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELN 537 D +G G+YG N +V + +SLE I E+LN Sbjct: 24 DEIGKGAYGRVYIGLDLENGDFVAIKQVSLENIGQEDLN 62 >At3g07400.1 68416.m00882 lipase class 3 family protein contains Pfam profile PF01764: Lipase Length = 1003 Score = 27.5 bits (58), Expect = 9.8 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = -3 Query: 596 PSYVPLGSISLEGIVSEELNMSVGIFPWSRACRFRPSVKSLL*RMQSQ*MNA 441 PSYVP G + L G S E ++S G +S+ R + L R+QS M + Sbjct: 454 PSYVPFGELYLLGTASVE-SLSEG--EYSKLTSVRSVITELRERLQSHSMKS 502 >At1g74800.1 68414.m08666 galactosyltransferase family protein contains Pfam profile: PF01762 galactosyltransferase Length = 672 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -3 Query: 275 SQ*TACGKTWLTD-LVTVRRALEFFFTEVDSVEGIEVEMVKECDHFVD 135 S+ A K+W+ L+T + + FF + + + VE+ KE ++F D Sbjct: 437 SERMAVRKSWMQHVLITSAKVVARFFVALHGRKEVNVELKKEAEYFGD 484 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,384,486 Number of Sequences: 28952 Number of extensions: 317023 Number of successful extensions: 1036 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 982 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1032 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -