BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00790 (759 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47925| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42199| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_29934| Best HMM Match : Vicilin_N (HMM E-Value=1.4) 40 0.002 SB_57155| Best HMM Match : RTP (HMM E-Value=4.2) 40 0.002 SB_48079| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) 38 0.007 SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 38 0.007 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 38 0.007 SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 38 0.007 SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) 38 0.007 SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) 38 0.007 SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) 38 0.007 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 38 0.007 SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1) 38 0.007 SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 38 0.007 SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) 38 0.007 SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) 38 0.007 SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) 38 0.007 SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) 38 0.007 SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 38 0.007 SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) 38 0.007 SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) 38 0.009 SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) 38 0.012 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 38 0.012 SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) 37 0.015 SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) 37 0.015 SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_28986| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) 35 0.062 SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_28333| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.082 SB_24941| Best HMM Match : DPRP (HMM E-Value=1) 35 0.082 SB_47792| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6) 35 0.082 SB_46702| Best HMM Match : LETM1 (HMM E-Value=5.5) 35 0.082 SB_29550| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.082 SB_18732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) 35 0.082 SB_13171| Best HMM Match : AT_hook (HMM E-Value=6.4) 35 0.082 SB_56583| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6) 34 0.11 SB_32967| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_57364| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_24913| Best HMM Match : RVT_1 (HMM E-Value=1e-20) 34 0.14 SB_24501| Best HMM Match : RVT_1 (HMM E-Value=4.2e-37) 34 0.14 SB_6135| Best HMM Match : CSD (HMM E-Value=5.4) 34 0.14 SB_23032| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 33 0.19 SB_19159| Best HMM Match : RVT_1 (HMM E-Value=0.00032) 33 0.19 SB_59249| Best HMM Match : zf-C2H2 (HMM E-Value=0.016) 33 0.25 SB_58492| Best HMM Match : DUF1196 (HMM E-Value=5) 33 0.25 SB_55051| Best HMM Match : RVT_1 (HMM E-Value=0.014) 33 0.25 SB_54448| Best HMM Match : RVT_1 (HMM E-Value=0.096) 33 0.25 SB_52360| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 33 0.25 SB_50181| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 33 0.25 SB_42604| Best HMM Match : DUF1196 (HMM E-Value=5) 33 0.25 SB_41718| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) 33 0.25 SB_41510| Best HMM Match : Minor_tail_Z (HMM E-Value=3.5) 33 0.25 SB_40055| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 33 0.25 SB_32337| Best HMM Match : CaMBD (HMM E-Value=5.9) 33 0.25 SB_19821| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_14835| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 33 0.25 SB_14424| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 33 0.25 SB_14108| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 33 0.25 SB_12029| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 33 0.25 SB_10362| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_9519| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 33 0.25 SB_3604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_263| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 33 0.25 SB_58157| Best HMM Match : RVT_1 (HMM E-Value=1.6e-36) 33 0.25 SB_58057| Best HMM Match : RVT_1 (HMM E-Value=0.0085) 33 0.25 SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_47109| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_35729| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 33 0.25 SB_28415| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 33 0.25 SB_26934| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 33 0.25 SB_10529| Best HMM Match : zf-C2H2 (HMM E-Value=0.0034) 33 0.25 SB_6922| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) 33 0.25 SB_6390| Best HMM Match : BCL_N (HMM E-Value=8.4) 33 0.25 SB_5327| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 33 0.25 SB_2372| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 33 0.25 SB_54320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_49315| Best HMM Match : Calreticulin (HMM E-Value=0) 33 0.33 SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42) 32 0.44 SB_55887| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.58 SB_54945| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.58 SB_54859| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.58 SB_49557| Best HMM Match : RVT_1 (HMM E-Value=0.58) 32 0.58 SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) 32 0.58 SB_46852| Best HMM Match : AT_hook (HMM E-Value=2.6) 32 0.58 SB_46782| Best HMM Match : DUF1610 (HMM E-Value=0.97) 32 0.58 SB_45857| Best HMM Match : DUF1274 (HMM E-Value=2.4) 32 0.58 SB_43890| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.58 SB_38360| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.58 SB_37313| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.58 SB_36139| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.58 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 32 0.58 SB_32772| Best HMM Match : AT_hook (HMM E-Value=2.6) 32 0.58 SB_32387| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.58 SB_21106| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.58 SB_21043| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.58 SB_12170| Best HMM Match : RVT_1 (HMM E-Value=0.58) 32 0.58 SB_8476| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.58 SB_59259| Best HMM Match : AT_hook (HMM E-Value=2.6) 32 0.58 SB_58038| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.58 SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) 32 0.58 SB_56412| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.58 SB_54746| Best HMM Match : RVT_1 (HMM E-Value=8.4e-11) 32 0.58 SB_45064| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.58 SB_43639| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.58 SB_42325| Best HMM Match : RVT_1 (HMM E-Value=0.52) 32 0.58 SB_41989| Best HMM Match : RVT_1 (HMM E-Value=1.2e-33) 32 0.58 SB_40565| Best HMM Match : DUF1274 (HMM E-Value=6.2) 32 0.58 SB_26530| Best HMM Match : RVT_1 (HMM E-Value=0.58) 32 0.58 SB_24790| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.58 SB_23124| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.58 SB_23084| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.58 SB_22656| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.58 SB_16102| Best HMM Match : RVT_1 (HMM E-Value=0.00065) 32 0.58 SB_12973| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.58 SB_11315| Best HMM Match : AT_hook (HMM E-Value=2.6) 32 0.58 SB_10586| Best HMM Match : RVT_1 (HMM E-Value=0.039) 32 0.58 SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.58 SB_4403| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.58 SB_2120| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.58 SB_1327| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.58 SB_17682| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.77 SB_30735| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 0.77 SB_51049| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_23180| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_50765| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) 31 1.0 SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_36149| Best HMM Match : AT_hook (HMM E-Value=2.6) 31 1.0 SB_8297| Best HMM Match : RVT_1 (HMM E-Value=0.46) 31 1.0 SB_47293| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4e-06) 31 1.3 SB_24663| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05) 30 2.3 SB_2707| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_31729| Best HMM Match : RVT_1 (HMM E-Value=0.023) 30 2.3 SB_25560| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_36643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_50945| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_21297| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_50753| Best HMM Match : zf-C2H2 (HMM E-Value=0.012) 29 4.1 SB_58975| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_34166| Best HMM Match : RVT_1 (HMM E-Value=1e-23) 29 5.4 SB_6541| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_36081| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_15292| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_53195| Best HMM Match : CaMBD (HMM E-Value=1.4) 28 9.5 SB_36804| Best HMM Match : tRNA_int_endo (HMM E-Value=3.9) 28 9.5 >SB_47925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY+ ETWT+ S K++D M C R++LQ+ W + Sbjct: 109 LYSCETWTVYSSHAKKLDRFHMNCLRKILQVRWQD 143 >SB_42199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY+ ETWT+ S K++D M C R++LQ+ W + Sbjct: 109 LYSCETWTVYSSHAKKLDRFHMNCLRKILQVRWQD 143 >SB_29934| Best HMM Match : Vicilin_N (HMM E-Value=1.4) Length = 290 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY ETW + + + K +D + C RR+L+ISW + Sbjct: 147 SVLLYGCETWKMNKKDDKLLDVFQQKCLRRILKISWED 184 >SB_57155| Best HMM Match : RTP (HMM E-Value=4.2) Length = 237 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY ETW + + + K +D + C RR+L+ISW + Sbjct: 86 SVLLYGCETWKMNKKDDKLLDVFQQKCLRRILKISWED 123 >SB_48079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY ETW + + + K +D + C RR+L+ISW + Sbjct: 234 SVLLYGCETWKMNKKDDKLLDVFQQKCLRRILKISWED 271 >SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) Length = 449 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 61 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 98 >SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 226 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 29 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 66 >SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) Length = 677 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 501 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 538 >SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 579 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 616 >SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 223 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 29 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 66 >SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) Length = 590 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 541 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 578 >SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 110 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 147 >SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 109 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 146 >SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) Length = 754 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 29 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 66 >SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) Length = 458 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 330 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 367 >SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 92 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 29 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 66 >SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 226 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 29 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 66 >SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 290 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 162 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 199 >SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 145 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 182 >SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 110 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 147 >SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 406 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 29 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 66 >SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) Length = 322 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 259 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 296 >SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 416 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 219 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 256 >SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 348 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 162 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 199 >SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 29 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 66 >SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 173 Score = 37.9 bits (84), Expect = 0.009 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +E+WT ++KR++ M C RR+L I W++ Sbjct: 113 LYGSESWTTYARQEKRLNTFHMRCLRRILGIHWSD 147 >SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 37.5 bits (83), Expect = 0.012 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR+ M C RR+L I W++ Sbjct: 110 STLLYGSESWTTYARQEKRLHTFHMRCLRRILGIHWSD 147 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 37.5 bits (83), Expect = 0.012 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E WT ++KR++ M C RR+L I W++ Sbjct: 2421 STLLYGSEPWTTYARQEKRLNTFHMRCLRRILGIHWSD 2458 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 37.5 bits (83), Expect = 0.012 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR+ M C RR+L I W++ Sbjct: 110 STLLYGSESWTTYARQEKRLHTFHMRCLRRILGIHWSD 147 >SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 370 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISW 750 + LY +E+WT ++KR++ M C RR+L I W Sbjct: 193 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 228 >SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) Length = 661 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISW 750 + LY +E+WT ++KR++ M C RR+L I W Sbjct: 490 STLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 525 >SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 36.7 bits (81), Expect = 0.020 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C RR+ +I W++ Sbjct: 623 STLLYGSESWTTYARQEKRLNTFHMRCLRRIPRIHWSD 660 >SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 36.7 bits (81), Expect = 0.020 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +++WT ++KR++ M C RR+L I W++ Sbjct: 145 STLLYGSKSWTTYARQEKRLNTFHMRCLRRILGIHWSD 182 >SB_28986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 35.5 bits (78), Expect = 0.047 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY ETW + + + K +D + RR+L+ISW + Sbjct: 504 SVLLYGCETWKMNKKDDKLLDVFQQKYLRRILKISWED 541 >SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) Length = 530 Score = 35.1 bits (77), Expect = 0.062 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C R+L I W++ Sbjct: 333 STLLYGSESWTTYARQEKRLNTFHMRCLCRILGIHWSD 370 >SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 35.1 bits (77), Expect = 0.062 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E+WT ++KR++ M C R+L I W++ Sbjct: 213 STLLYGSESWTTYARQEKRLNTFHMRCLCRILGIHWSD 250 >SB_28333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 34.7 bits (76), Expect = 0.082 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 +A +Y AETWT+ S+ K + A M R +++I+W + Sbjct: 170 SALVYGAETWTVYRSQVKNLHAYMMRHLREIMKITWMD 207 >SB_24941| Best HMM Match : DPRP (HMM E-Value=1) Length = 354 Score = 34.7 bits (76), Expect = 0.082 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 +A +Y AETWT+ S+ K + A M R +++I+W + Sbjct: 170 SALVYGAETWTVYRSQVKNLHAYMMRHLREIMKITWMD 207 >SB_47792| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6) Length = 255 Score = 34.7 bits (76), Expect = 0.082 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 +A +Y AETWT+ S+ K + A M R +++I+W + Sbjct: 119 SALVYGAETWTVYRSQVKNLHAYMMRHLREIMKITWMD 156 >SB_46702| Best HMM Match : LETM1 (HMM E-Value=5.5) Length = 306 Score = 34.7 bits (76), Expect = 0.082 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 +A +Y AETWT+ S+ K + A M R +++I+W + Sbjct: 170 SALVYGAETWTVYRSQVKNLHAYMMRHLREIMKITWMD 207 >SB_29550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 464 Score = 34.7 bits (76), Expect = 0.082 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 +A +Y AETWT+ S+ K + A M R +++I+W + Sbjct: 362 SALVYGAETWTVYRSQVKNLHAYMMRHLREIMKITWMD 399 >SB_18732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) Length = 1582 Score = 34.7 bits (76), Expect = 0.082 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 +A +Y AETWT+ S+ K + A M R +++I+W + Sbjct: 1480 SALVYGAETWTVYRSQVKNLHAYMMRHLREIMKITWMD 1517 >SB_13171| Best HMM Match : AT_hook (HMM E-Value=6.4) Length = 188 Score = 34.7 bits (76), Expect = 0.082 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 +A +Y AETWT+ S+ K + A M R +++I+W + Sbjct: 52 SALVYGAETWTVYRSQVKNLHAYMMRHLREIMKITWMD 89 >SB_56583| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6) Length = 234 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 +A +Y AETWT+ S+ K + A M R +++I+W + Sbjct: 128 SALVYGAETWTVYRSQVKTLHAYMMRHLREIMKITWMD 165 >SB_32967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 33.9 bits (74), Expect = 0.14 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 646 AFLYAAETWTLRESEKKRIDALEMWCWRRMLQISW 750 + LYA ETWT+ + ++++ C R++L I W Sbjct: 233 SLLYACETWTVYQRHARKLNHFHTICLRKILGIKW 267 >SB_57364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 33.9 bits (74), Expect = 0.14 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 646 AFLYAAETWTLRESEKKRIDALEMWCWRRMLQISW 750 + LYA ETWT+ + ++++ C R++L I W Sbjct: 140 SLLYACETWTVYQRHARKLNHFHTICLRKILGIKW 174 >SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 33.9 bits (74), Expect = 0.14 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 646 AFLYAAETWTLRESEKKRIDALEMWCWRRMLQISW 750 + LYA ETWT+ + ++++ C R++L I W Sbjct: 384 SLLYACETWTVYQRHARKLNHFHTICLRKILGIKW 418 >SB_24913| Best HMM Match : RVT_1 (HMM E-Value=1e-20) Length = 906 Score = 33.9 bits (74), Expect = 0.14 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 646 AFLYAAETWTLRESEKKRIDALEMWCWRRMLQISW 750 + LYA ETWT+ + ++++ C R++L I W Sbjct: 684 SLLYACETWTVYQRHARKLNHFHTICLRKILGIKW 718 >SB_24501| Best HMM Match : RVT_1 (HMM E-Value=4.2e-37) Length = 565 Score = 33.9 bits (74), Expect = 0.14 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 646 AFLYAAETWTLRESEKKRIDALEMWCWRRMLQISW 750 + LYA ETWT+ + ++++ C R++L I W Sbjct: 379 SLLYACETWTVYQRHARKLNHFHTICLRKILGIKW 413 >SB_6135| Best HMM Match : CSD (HMM E-Value=5.4) Length = 254 Score = 33.9 bits (74), Expect = 0.14 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 646 AFLYAAETWTLRESEKKRIDALEMWCWRRMLQISW 750 + LYA ETWT+ + ++++ C R++L I W Sbjct: 74 SLLYACETWTVYQRHARKLNHFHTICLRKILGIKW 108 >SB_23032| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) Length = 855 Score = 33.5 bits (73), Expect = 0.19 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +ETWT+ + +++ C R++L + W E Sbjct: 667 STLLYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 704 >SB_19159| Best HMM Match : RVT_1 (HMM E-Value=0.00032) Length = 426 Score = 33.5 bits (73), Expect = 0.19 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 +A +Y AETWT+ S+ K + A M + +++I+W + Sbjct: 290 SALVYGAETWTVYRSQVKNLHAYMMRHLKEIMKITWMD 327 >SB_59249| Best HMM Match : zf-C2H2 (HMM E-Value=0.016) Length = 236 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 51 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 85 >SB_58492| Best HMM Match : DUF1196 (HMM E-Value=5) Length = 283 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 170 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 204 >SB_55051| Best HMM Match : RVT_1 (HMM E-Value=0.014) Length = 372 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 270 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 304 >SB_54448| Best HMM Match : RVT_1 (HMM E-Value=0.096) Length = 343 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY ETWT+ +K + + C R +L I W + Sbjct: 276 LYGCETWTIYRRHEKLLQQFHLRCLRNILNIRWQD 310 >SB_52360| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 455 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 270 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 304 >SB_50181| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 503 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 318 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 352 >SB_42604| Best HMM Match : DUF1196 (HMM E-Value=5) Length = 294 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 171 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 205 >SB_41718| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) Length = 470 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY ETWT+ +K + + C R +L I W + Sbjct: 403 LYGCETWTIYRRHEKLLQQFHLRCLRNILNIRWQD 437 >SB_41510| Best HMM Match : Minor_tail_Z (HMM E-Value=3.5) Length = 208 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY ETWT+ +K + + C R +L I W + Sbjct: 87 LYGCETWTIYRRHEKLLQQFHLRCLRNILNIRWQD 121 >SB_40055| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 303 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY ETWT+ +K + + C R +L I W + Sbjct: 113 LYGCETWTIYRRHEKLLQQFHLRCLRNILNIRWQD 147 >SB_32337| Best HMM Match : CaMBD (HMM E-Value=5.9) Length = 289 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY ETWT+ +K + + C R +L I W + Sbjct: 208 LYGCETWTIYRRHEKLLQQFHLRCLRNILNIRWQD 242 >SB_19821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY ETWT+ +K + + C R +L I W + Sbjct: 338 LYGCETWTIYRRHEKLLQQFHLRCLRNILNIRWQD 372 >SB_14835| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 382 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 197 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 231 >SB_14424| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 272 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 87 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 121 >SB_14108| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 404 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY ETWT+ +K + + C R +L I W + Sbjct: 214 LYGCETWTIYRRHEKLLQQFHLRCLRNILNIRWQD 248 >SB_12029| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 192 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +1 Query: 664 ETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 E+WT ++KR++ M C RR+L I W++ Sbjct: 2 ESWTTYARQEKRLNTFHMRCLRRILGIHWSD 32 >SB_10362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 171 LYGSETWTIYKHHAMKLNHFHTTCLRKILDVRWQE 205 >SB_9519| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 299 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY ETWT+ +K + + C R +L I W + Sbjct: 109 LYGCETWTIYRRHEKLLQQFHLRCLRNILNIRWQD 143 >SB_3604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1319 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY ETWT+ +K + + C R +L I W + Sbjct: 1129 LYGCETWTIYRRHEKLLQQFHLRCLRNILNIRWQD 1163 >SB_263| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 272 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 87 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 121 >SB_58157| Best HMM Match : RVT_1 (HMM E-Value=1.6e-36) Length = 1092 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 907 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 941 >SB_58057| Best HMM Match : RVT_1 (HMM E-Value=0.0085) Length = 576 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 402 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 436 >SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1395 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 947 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 981 >SB_47109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 87 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 121 >SB_35729| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 237 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 52 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 86 >SB_28415| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 356 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 171 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 205 >SB_26934| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 1443 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 1258 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 1292 >SB_10529| Best HMM Match : zf-C2H2 (HMM E-Value=0.0034) Length = 272 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 87 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 121 >SB_6922| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) Length = 425 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY ETWT+ +K + + C R +L I W + Sbjct: 344 LYGCETWTIYRRHEKLLQQFHLRCLRNILNIRWQD 378 >SB_6390| Best HMM Match : BCL_N (HMM E-Value=8.4) Length = 194 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY ETWT+ +K + + C R +L I W + Sbjct: 154 LYGCETWTIYRRHEKLLQQFHLRCLRNILNIRWQD 188 >SB_5327| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 328 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY ETWT+ +K + + C R +L I W + Sbjct: 138 LYGCETWTIYRRHEKLLQQFHLRCLRNILNIRWQD 172 >SB_2372| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 414 Score = 33.1 bits (72), Expect = 0.25 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 229 LYGSETWTIYKRHAMKLNHFHTTCLRKILNVRWQE 263 >SB_54320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 32.7 bits (71), Expect = 0.33 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 61 LYGSETWTIYKRHALKLNHFHTTCLRKILNVRWQE 95 >SB_49315| Best HMM Match : Calreticulin (HMM E-Value=0) Length = 1086 Score = 32.7 bits (71), Expect = 0.33 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + +++ C R++L + W E Sbjct: 549 LYGSETWTIYKRHALKLNHFHTTCLRKILNVRWQE 583 >SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQI 744 + LY +E+WT ++KR+ M C RR+L I Sbjct: 110 STLLYGSESWTTYARQEKRLHTFHMRCLRRILGI 143 >SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQI 744 + LY +E+WT ++KR+ M C RR+L I Sbjct: 110 STLLYGSESWTTYARQEKRLHTFHMRCLRRILGI 143 >SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42) Length = 717 Score = 32.3 bits (70), Expect = 0.44 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRML 738 + LY +E+WT ++KR++ M C RR+L Sbjct: 685 STLLYGSESWTTYARQEKRLNTFHMRCLRRIL 716 >SB_55887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 138 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 173 >SB_54945| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 392 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 250 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 285 >SB_54859| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 559 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 474 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 509 >SB_49557| Best HMM Match : RVT_1 (HMM E-Value=0.58) Length = 404 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 248 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 283 >SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) Length = 1074 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 918 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 953 >SB_46852| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 294 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 138 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 173 >SB_46782| Best HMM Match : DUF1610 (HMM E-Value=0.97) Length = 451 Score = 31.9 bits (69), Expect = 0.58 Identities = 17/69 (24%), Positives = 36/69 (52%) Frame = +2 Query: 284 KDVLKITFPLKQKQPEDSQTPIVEPTKTTSTNESREEMEFTTKNNVRDADVSLETAQKFN 463 K V+K T P ++ + + V PTK+ S + R + ++ ++ D + E++QK + Sbjct: 245 KAVIKRTIPSSDEEDSEKEKTPVTPTKSKSPTKIRRLLS-SSSDSASDEESCQESSQKSD 303 Query: 464 EIANAVETT 490 E+ +T+ Sbjct: 304 ELDQTFKTS 312 >SB_45857| Best HMM Match : DUF1274 (HMM E-Value=2.4) Length = 288 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 138 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 173 >SB_43890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 47 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 82 >SB_38360| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 387 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 231 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 266 >SB_37313| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 47 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 82 >SB_36139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 279 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 314 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 685 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 720 >SB_32772| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 255 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 99 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 134 >SB_32387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 912 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 758 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 793 >SB_21106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 47 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 82 >SB_21043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 86 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 121 >SB_12170| Best HMM Match : RVT_1 (HMM E-Value=0.58) Length = 294 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 248 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 283 >SB_8476| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 202 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 93 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 128 >SB_59259| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 203 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 47 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 82 >SB_58038| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 201 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 45 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 80 >SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) Length = 492 Score = 31.9 bits (69), Expect = 0.58 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY AETW + K+I C R++L+I W + Sbjct: 353 LYGAETWRTTVTTMKKIQVFINTCLRKILKIRWPD 387 >SB_56412| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 93 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 128 >SB_54746| Best HMM Match : RVT_1 (HMM E-Value=8.4e-11) Length = 959 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY ETWT+ +K + + C R +L I W + Sbjct: 833 LYGWETWTIYRRHEKLLQQFHLRCLRNILNIRWQD 867 >SB_45064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 37 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 72 >SB_43639| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 93 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWEDY 128 >SB_42325| Best HMM Match : RVT_1 (HMM E-Value=0.52) Length = 333 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 248 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 283 >SB_41989| Best HMM Match : RVT_1 (HMM E-Value=1.2e-33) Length = 585 Score = 31.9 bits (69), Expect = 0.58 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY AETW + K+I C R++L+I W + Sbjct: 411 LYGAETWRTTVTTMKKIQVFINTCLRKILKIRWPD 445 >SB_40565| Best HMM Match : DUF1274 (HMM E-Value=6.2) Length = 294 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 138 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 173 >SB_26530| Best HMM Match : RVT_1 (HMM E-Value=0.58) Length = 359 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 248 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 283 >SB_24790| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 226 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 70 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 105 >SB_23124| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 47 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 82 >SB_23084| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 93 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 128 >SB_22656| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 93 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 128 >SB_16102| Best HMM Match : RVT_1 (HMM E-Value=0.00065) Length = 435 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 279 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 314 >SB_12973| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 93 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 128 >SB_11315| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 294 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 138 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 173 >SB_10586| Best HMM Match : RVT_1 (HMM E-Value=0.039) Length = 590 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 434 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 469 >SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 99 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 134 >SB_4403| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 138 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 173 >SB_2120| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 235 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 125 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 160 >SB_1327| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 47 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDDY 82 >SB_17682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 31.5 bits (68), Expect = 0.77 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +2 Query: 311 LKQKQPEDSQTPIVEPTKTTSTNESREEMEFTTKNNVRDADVSLETAQKFNEIANAVETT 490 +K+K+ + +V+P +S ES EE F T + D+DV + + K E+ +E Sbjct: 333 VKKKKAQGVADFVVDPRAASSPVESEEESSFPTSSRSTDSDVRM-SGGKLKEMKIEIEFL 391 Query: 491 THAVNFET 514 V E+ Sbjct: 392 RRRVEDES 399 >SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 591 Score = 31.5 bits (68), Expect = 0.77 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 397 LYGSETWTVYQHEVRELCTLQQRHLRLILKIKWDDY 432 >SB_30735| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 31.5 bits (68), Expect = 0.77 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + + L+ R +L+I W ++ Sbjct: 93 LYGSETWTVYQHEVRELRTLQQRHLRLILKIMWDDY 128 >SB_51049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY AETW + K+I C R++L+I W + Sbjct: 107 LYGAETWRNTVTTMKKIQVFINTCLRKILKIRWPD 141 >SB_23180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY AETW + K+I C R++L+I W + Sbjct: 134 LYGAETWRNTVTTMKKIQVFINTCLRKILKIRWPD 168 >SB_50765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 31.1 bits (67), Expect = 1.0 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +1 Query: 646 AFLYAAETWTLRESEKKRIDALEMWCWRRMLQISW 750 A LY E+WT+ + ++++ C R++ I+W Sbjct: 222 ALLYGCESWTVYQRHSRKLNHFHTTCLRKLRGITW 256 >SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) Length = 1641 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY AETW + K+I C R++L+I W + Sbjct: 108 LYGAETWRNTVTTMKKIQVFINTCLRKILKIRWPD 142 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY AETW + K+I C R++L+I W + Sbjct: 468 LYGAETWRNTVTTMKKIQVFINTCLRKILKIRWPD 502 >SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 646 AFLYAAETWTLRESEKKRIDALEMWCWRRMLQIS 747 + LYA ETWT+ + ++++ C R++L IS Sbjct: 174 SLLYACETWTVYQRHARKLNHFHTICLRKILGIS 207 >SB_36149| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 294 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 LY +ETWT+ + E + L+ R +L+I W ++ Sbjct: 138 LYGSETWTVYQHEVREFRTLQQRHLRLILKIKWDDY 173 >SB_8297| Best HMM Match : RVT_1 (HMM E-Value=0.46) Length = 404 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 649 FLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTEF 759 F+Y +ETWT+ + E + L+ R +L+I W ++ Sbjct: 247 FMYGSETWTVYQHEVREPCTLQQRHLRLILKIKWDDY 283 >SB_47293| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4e-06) Length = 744 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY +ETWT+ + E + + L+ R +L+I W + Sbjct: 588 LYGSETWTVYQHEVRELRTLQQRHLRLILKIKWDD 622 >SB_24663| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05) Length = 666 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/38 (26%), Positives = 22/38 (57%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E W++ +++ +I A C R++ +I W + Sbjct: 524 SVLLYGSECWSIVKADMDKISAFHNVCLRKICRIFWPQ 561 >SB_2707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISW 750 LY AETW K+I C R++L+I W Sbjct: 26 LYGAETWRTTVITMKKIPVFINTCLRKILKIRW 58 >SB_31729| Best HMM Match : RVT_1 (HMM E-Value=0.023) Length = 423 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY AETW K+I C R++L+I W + Sbjct: 344 LYGAETWRNTVITMKKIQVFINTCLRKILKIRWPD 378 >SB_25560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 629 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 +Y AETW + K+I C R++L+I W + Sbjct: 563 VYGAETWRTTVTTIKKIQVFINTCLRKILKIRWPD 597 >SB_36643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 537 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 652 LYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 LY AETW K+I C R++L+I W + Sbjct: 458 LYGAETWRNTVITMKKIPVFINTCLRKILKIRWPD 492 >SB_50945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 29.1 bits (62), Expect = 4.1 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 9/95 (9%) Frame = +2 Query: 311 LKQKQPEDSQTPIVEPT------KT---TSTNESREEMEFTTKNNVRDADVSLETAQKFN 463 L+Q + E+ +P+ EP KT T E + R A L A + Sbjct: 706 LRQTRRENKLSPVFEPEAYKVLQKTVRFTGVPTKGYETRLAPDHEQRRAPTILNRAARVV 765 Query: 464 EIANAVETTTHAVNFETMCSSCRIHINLIKYKCEN 568 ++ + ++++ T+ S +IHI+++ YKC N Sbjct: 766 AREDSFKQAMQSLHWPTLNISSKIHISVLVYKCLN 800 >SB_21297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 29.1 bits (62), Expect = 4.1 Identities = 19/57 (33%), Positives = 29/57 (50%) Frame = +2 Query: 287 DVLKITFPLKQKQPEDSQTPIVEPTKTTSTNESREEMEFTTKNNVRDADVSLETAQK 457 D+L+I ++ S +P EPT +STN+ +EEM + +A LE A K Sbjct: 19 DLLEINNAIRPNFQLVSVSP-QEPTPLSSTNDDQEEMGKLFAQSFAEAAADLEKAMK 74 >SB_50753| Best HMM Match : zf-C2H2 (HMM E-Value=0.012) Length = 401 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +1 Query: 646 AFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY ETWTL K+++ R +++I W + Sbjct: 217 SLLYGCETWTLYRRHIKKLEQFHTRSLRAIMRIRWQD 253 >SB_58975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 28.7 bits (61), Expect = 5.4 Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -3 Query: 598 YLYVHLFITLILTFIFDQINMDSARTAHR-LEVDSVSSRFYSVRDLIELLSCLQADVS 428 +++ +L + +++T + + M+ +T + EVD + S+ S DL+ SC VS Sbjct: 446 FVFANLVVAVVVTNL--EFAMEDVKTEGKEREVDDLKSKLESENDLVNTTSCTDIPVS 501 >SB_34166| Best HMM Match : RVT_1 (HMM E-Value=1e-23) Length = 385 Score = 28.7 bits (61), Expect = 5.4 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = +1 Query: 643 AAFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY +E W + +++ +I A C R++ I W + Sbjct: 297 SVLLYGSECWRVVKADMDKISAFHNGCLRKICHIFWPQ 334 >SB_6541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 646 AFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY ETWTL K+++ R ++ I W + Sbjct: 613 SLLYGCETWTLYRRHIKKLEQFHTRSLRAIMHIRWQD 649 >SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 230 ENTEPSPRLNPEGNWIYEKDVLKITFPLKQKQPEDSQTPIVEPTKTTST 376 +NT P P PEG +V T P + K + + P+ +P +TT++ Sbjct: 261 KNTAPQPETQPEGTTASTPEVPGPTQPTQTK--KTTTKPVSQPGETTAS 307 >SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2851 Score = 28.3 bits (60), Expect = 7.2 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 6/68 (8%) Frame = +2 Query: 281 EKDVLKITFPLKQKQPEDSQT---PIVEPTKTTSTNESREEMEFTTKNNV---RDADVSL 442 E V +T P + K SQ P E T +TN+ +++ TKN+ + +D S Sbjct: 1854 ENKVAALTEPAEGKATATSQIKGDPDTESTLEDTTNDEKKDDTIETKNDAQPRKGSDYST 1913 Query: 443 ETAQKFNE 466 ++ ++ NE Sbjct: 1914 DSGERSNE 1921 >SB_36081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 424 Score = 27.9 bits (59), Expect = 9.5 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 3/79 (3%) Frame = +2 Query: 230 ENTEPSPRLNPEGNWIYEKDVLKITFPLKQKQPEDSQTPIVEPTKTTSTNESREEMEFT- 406 ENT NP+ + K K K + E + TP VE E + + E T Sbjct: 331 ENTSQVKAYNPDADSTIGKSAKKRKHE-KSDEEETAATPEVESPPKKHKKEKKSKKEKTK 389 Query: 407 TKNNVRDADVS--LETAQK 457 T+ + +AD+S LE +K Sbjct: 390 TEESDEEADISAVLENGEK 408 >SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1231 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +2 Query: 401 FTTKNNVRDADVSLETAQKFNEIANAVETTTHAVNFETMCSSCRI 535 F + +V D DV+L KF E+ T A + E +SC + Sbjct: 135 FEEQRSVTDTDVALNKEMKFEEVELESVTEQEASDVEKPLTSCEM 179 >SB_15292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 983 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 682 ESEKKRIDALEMWCWRRMLQISW 750 E++KKR+ A+E W W +L W Sbjct: 784 ENKKKRMYAIESWRWNTLLLPHW 806 >SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 686 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 646 AFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY ETWTL K++ R +++I W + Sbjct: 446 SLLYGCETWTLYRRHIKKLGQFHTRSLRAIMRIRWQD 482 >SB_53195| Best HMM Match : CaMBD (HMM E-Value=1.4) Length = 83 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 646 AFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY ETWTL K++ R +++I W + Sbjct: 30 SLLYGCETWTLYRRHIKKLGQFHTRSLRAIMRIRWQD 66 >SB_36804| Best HMM Match : tRNA_int_endo (HMM E-Value=3.9) Length = 229 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 646 AFLYAAETWTLRESEKKRIDALEMWCWRRMLQISWTE 756 + LY ETWTL K++ R +++I W + Sbjct: 134 SLLYGCETWTLYRRHIKKLGQFHTRSLRAIMRIRWQD 170 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,690,838 Number of Sequences: 59808 Number of extensions: 409942 Number of successful extensions: 1602 Number of sequences better than 10.0: 161 Number of HSP's better than 10.0 without gapping: 1474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1599 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -