BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00786 (696 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 23 3.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 5.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.5 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 5.5 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.5 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 21 7.3 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 7.3 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 9.6 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 21 9.6 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 22.6 bits (46), Expect = 3.2 Identities = 16/50 (32%), Positives = 20/50 (40%) Frame = -3 Query: 679 GHQTPHLLELSMCMSCGVQVHRGGTCP*QCSMVRPFYGITLAGREPAQWD 530 G TP E S V G P + ++ FYG T +PAQ D Sbjct: 224 GADTPWQREYENVNSTVVNWVNAGADPGKLTIGLAFYGHTFQLADPAQHD 273 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 180 ALTNGKVLWPLLEER 136 A G V+WP++E+R Sbjct: 236 AQATGFVVWPIIEQR 250 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 180 ALTNGKVLWPLLEER 136 A G V+WP++E+R Sbjct: 236 AQATGFVVWPIIEQR 250 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 180 ALTNGKVLWPLLEER 136 A G V+WP++E+R Sbjct: 236 AQATGFVVWPIIEQR 250 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 180 ALTNGKVLWPLLEER 136 A G V+WP++E+R Sbjct: 236 AQATGFVVWPIIEQR 250 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 21.4 bits (43), Expect = 7.3 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +1 Query: 544 VLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCLALTNVESG 675 VLF+ + +GV Y ++ G+SR + + T LAL ++ G Sbjct: 33 VLFVIIVAGNVGVLYTLLFGRSRKSRMNY--FITHLALADLSVG 74 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 434 TKEAQHHPIRHKHSHQA 484 TK HH I+ +H HQ+ Sbjct: 101 TKFNPHHEIKLQHLHQS 117 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.0 bits (42), Expect = 9.6 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 Query: 427 SLHQRGPTPSDPAQTQSPS 483 ++HQ+GP P Q P+ Sbjct: 197 NMHQQGPPHQQPPIQQQPN 215 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.0 bits (42), Expect = 9.6 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 Query: 427 SLHQRGPTPSDPAQTQSPS 483 ++HQ+GP P Q P+ Sbjct: 199 NMHQQGPPHQQPPIQQQPN 217 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,305 Number of Sequences: 336 Number of extensions: 3314 Number of successful extensions: 10 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -