BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00785 (839 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 23 3.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 3.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 3.0 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 3.0 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 108 HMDIIYFSLFHLNINSVVLKCLWN 37 + +I+YFS +INS V L+N Sbjct: 331 YYNILYFSRIMFHINSAVNPILYN 354 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 143 YFISLLTFIALNIWI 99 +FI LL F AL WI Sbjct: 301 FFICLLPFRALTFWI 315 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.0 bits (47), Expect = 3.0 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 Query: 551 MIPHINSISNIFRKSLF*CEKMTSLVPALGYYGT 450 +IP + + RK L+ KM SL L +GT Sbjct: 130 LIPEVGTWIRAVRKCLYKLWKMPSLSEFLSLFGT 163 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.0 bits (47), Expect = 3.0 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 Query: 551 MIPHINSISNIFRKSLF*CEKMTSLVPALGYYGT 450 +IP + + RK L+ KM SL L +GT Sbjct: 130 LIPEVGTWIRAVRKCLYKLWKMPSLSEFLSLFGT 163 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.0 bits (47), Expect = 3.0 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 553 SYHQYFSHKYGQK 591 SYHQ SH YG++ Sbjct: 791 SYHQQQSHHYGRR 803 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,592 Number of Sequences: 336 Number of extensions: 3266 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23140487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -