SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00784
         (765 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8IBC6 Cluster: Putative uncharacterized protein MAL8P1...    38   0.27 

>UniRef50_Q8IBC6 Cluster: Putative uncharacterized protein MAL8P1.7;
            n=1; Plasmodium falciparum 3D7|Rep: Putative
            uncharacterized protein MAL8P1.7 - Plasmodium falciparum
            (isolate 3D7)
          Length = 2130

 Score = 37.9 bits (84), Expect = 0.27
 Identities = 20/69 (28%), Positives = 42/69 (60%), Gaps = 4/69 (5%)
 Frame = +2

Query: 116  EIFYRIIRRLY-GIENVFVGVGIKNLHNKVNGHKMRNVCLSRLWICSYVKRITLRKYMFV 292
            +++Y+++   + GI+N F+ +  KN  NK N +K+  +   +  + + +K+I  +KY+F+
Sbjct: 827  KLYYKMVSEKHKGIKNEFIELEPKNKKNK-NKNKINKIIKDKRKVYTPIKKIIKKKYIFI 885

Query: 293  Y---KLFRR 310
            Y   K+F R
Sbjct: 886  YDKTKIFTR 894


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 654,420,488
Number of Sequences: 1657284
Number of extensions: 11852379
Number of successful extensions: 26238
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 25081
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26229
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 63792713725
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -