BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00784 (765 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0994 - 13067254-13067379,13067483-13067521,13067824-130678... 30 1.8 01_04_0124 + 16359695-16359734,16360217-16360453,16361133-163621... 28 9.4 >03_02_0994 - 13067254-13067379,13067483-13067521,13067824-13067893, 13068025-13068116,13068237-13068319,13068590-13068633, 13068682-13068800,13068883-13068915,13069152-13069239, 13069364-13069413 Length = 247 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 160 CFCWCWNKKSTQQSEWS*NE-ECMSESAMDMQLCEENYFK 276 CFCW W +T ++ + + C S S D C EN K Sbjct: 92 CFCWIWLTGNTSTAKIAASAGSCYSVSLRDKHCCIENSMK 131 >01_04_0124 + 16359695-16359734,16360217-16360453,16361133-16362104, 16362211-16362398,16362564-16363942,16364024-16365047, 16365171-16365566,16367484-16367999,16368085-16368226, 16369409-16369553,16371351-16371432,16371851-16371895, 16372018-16372140 Length = 1762 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 733 DIFDFMVLISRSCSSFLIFGSDRSIYTSMI 644 ++F ++SR+C FL+F RS Y+S + Sbjct: 411 NLFKLREILSRNCGLFLLFSLLRSYYSSTL 440 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,559,355 Number of Sequences: 37544 Number of extensions: 282979 Number of successful extensions: 573 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 573 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2051430072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -