BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00784 (765 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66500-13|CAA91312.1| 1780|Caenorhabditis elegans Hypothetical p... 28 6.3 Z48334-10|CAA88315.1| 1780|Caenorhabditis elegans Hypothetical p... 28 6.3 Z37983-10|CAA86060.4| 267|Caenorhabditis elegans Hypothetical p... 28 8.4 >Z66500-13|CAA91312.1| 1780|Caenorhabditis elegans Hypothetical protein F10B5.7 protein. Length = 1780 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 749 SLFVKRYFRFYGSNIEIMFIVFNFWI 672 +LF++RY FYG I M + W+ Sbjct: 1510 ALFLRRYVYFYGDQIIKMLFILKVWL 1535 >Z48334-10|CAA88315.1| 1780|Caenorhabditis elegans Hypothetical protein F10B5.7 protein. Length = 1780 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 749 SLFVKRYFRFYGSNIEIMFIVFNFWI 672 +LF++RY FYG I M + W+ Sbjct: 1510 ALFLRRYVYFYGDQIIKMLFILKVWL 1535 >Z37983-10|CAA86060.4| 267|Caenorhabditis elegans Hypothetical protein B0393.7 protein. Length = 267 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 170 GVGIKNLHNKVNGHKMRNVCLSRLW--ICSY 256 GVG K V M N+CL R W IC+Y Sbjct: 80 GVGQKRCGKCVRPQDMANLCLDRKWQHICAY 110 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,950,802 Number of Sequences: 27780 Number of extensions: 314470 Number of successful extensions: 711 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 711 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1830096852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -